Entry information : ZmGPx[P]01-3
Entry ID 8563
Creation 2010-12-23 (Marie Brette (Scipio))
Last sequence changes 2011-09-28 (Marie Brette (Scipio))
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2015-10-26 (Christophe Dunand)
Peroxidase information: ZmGPx[P]01-3
Name ZmGPx[P]01-3
Class Plant glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmGPx[P]01-3
start..stop
S start..stop
ZmGPx01 152 3e-49 1..97 3..99
SpGPx01 148 8e-48 1..97 3..99
SbGPx01 148 8e-48 1..97 3..99
SiGPx01 148 1e-47 1..97 3..99
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 94221591..94221632 42 N° 2 94221958..94222034 77 N° 3 94222295..94222357 63 N° 4 94222513..94222620 108
join(94221591..94221632,94221958..94222034,94222295..94222357,94222513..94222620 )


exon

Literature and cross-references ZmGPx[P]01-3
Protein sequence: ZmGPx[P]01-3
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   96
PWM (Da):   %s   10353  
PI (pH):   %s   3.93
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ASSIFTSVHDFIVKDASGKVVDLTTYKGEVLLIVNIASQCGLNNSNYTELDKLSESTWTMVFEILVFPCNQFGGQEPGTNEEIVQFACTCF*AENX

Retrieve as FASTA  
Remarks Pseudogene from genomic (chromo 4)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCCTCGTCAATCTTCACCTCCGTCCATGATTTCATCGTCAAGGTCAGTCCCATTCCCCCCTATCGCCCTCTCAACCCTCGAACGTCTCTATGCGTAGATTCCAGAGGTGATATACTAATA
GGATCATAGGACCAAAATATTTCGCATGGAGCGCTTGCTTTGCATGTGGCGTGCCCTAGAGCTGCAAGCCCGAGACCGTTGTGTTATGCTAAGTCTAGGCTTGGTGCTTTAGTGGTTCCT
GATTTGTGTGGAGCTTAGTGTGAATTTTAGTGTCGATCAATTTAATTGGCTTGCAAAATGACTGAATTTGGTAACCATTTGTGTATATGAGTCTAATTGTTGCTTTTTTCTTGCTACTCA
TGTGCATGATGCGAGCGGCAAAGTCGTTGACCTCACCACCTACAAGGGGGAGGTTCTTCTCATCGTTAACATTGCATCCCAGTGGTATGAATCATCTGAAGCAGAACCTTACCTAACCTT
CTTACTATTGTCATTTACTCATTGTTTGGCCCATTGGAAAAGTGTATCAATAAGGTCGTTGGTGTCTTCTACTACCTGGAATCATTTGTTCCTGCTTGATATAAAATACTGCTTTTATTT
GTGCTTACTTATTTCACTTTGAGACGTAGACATCTTTTTTTACACTATATAGAAAACATTATTTTGTACACTGCTAATTGTTGCACTGTGACCGATTATTTCAGTGGCTTAAACAACTCT
AACTACACTGAGTTGGACAAGCTCTCTGAGAGTACATGGACCATGGT
GTGTCCTTAGTCTTGTAATGCTTGTATTTGTTCTCATGGGCATATGCGTTATTGGTTTACTTTATCCAACTAT
CGGTTGTTCATTGATTTCAACAATTCTCGTTGTTGGGGCTGCTAATTGCTAAGTACAATTTCCAATCTGTGATCTATGCAAGCTTTGAAATCTTGGTTTTCCCATGCAACCAGTTTGGTG
GNCAGGAGCCTGGTACCAATGAGGAGATTGTCCAGTTTGCCTGCACATGCTTCTAGGCTGAGAACCCCAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCCTCGTCAATCTTCACCTCCGTCCATGATTTCATCGTCAAGGATGCGAGCGGCAAAGTCGTTGACCTCACCACCTACAAGGGGGAGGTTCTTCTCATCGTTAACATTGCATCCCAGTGT
GGCTTAAACAACTCTAACTACACTGAGTTGGACAAGCTCTCTGAGAGTACATGGACCATGGT
CTTTGAAATCTTGGTTTTCCCATGCAACCAGTTTGGTGGNCAGGAGCCTGGTACCAAT
GAGGAGATTGTCCAGTTTGCCTGCACATGCTTCTAGGCTGAGAACCCCAT

Retrieve as FASTA