Entry information : Zm2CysPrx02 (GRMZM5G864335 [6a])
Entry ID 8568
Creation 2010-12-23 (Marie Brette (Scipio))
Last sequence changes 2011-09-28 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-07-08 (Christophe Dunand)
Peroxidase information: Zm2CysPrx02 (GRMZM5G864335 [6a])
Name (synonym) Zm2CysPrx02 (GRMZM5G864335 [6a])
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Zm2CysPrx02
start..stop
S start..stop
Sb2CysPrx 520 0 1..260 1..260
Zm2CysPrx01 508 0 1..260 1..260
Ta2CysPrx 435 5e-157 1..260 1..258
Os2CysPrx 428 3e-154 2..260 3..261
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 169839617..169839805 189 N° 2 169839903..169839977 75 N° 3 169840119..169840200 82 N° 4 169840290..169840369 80
N° 5 169842056..169842181 126 N° 6 169842297..169842410 114 N° 7 169843177..169843287 111 N° 8 169846694..169846699 6
join(169839617..169839805,169839903..169839977,169840119..169840200,169840290..1 69840369,169842056..169842181,169842297..169842410,169843177..169843287,16984669 4..169846699)


exon

Literature and cross-references Zm2CysPrx02 (GRMZM5G864335 [6a])
Protein sequence: Zm2CysPrx02 (GRMZM5G864335 [6a])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   260
PWM (Da):   %s   28047.53  
PI (pH):   %s   5.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSFAAATVVSSAPTPAARPLAVAPQSVSVSRSAVATAARPLRLVASRSARATRLVARAGGVDDLPLVGNKAPDFEAEAVFDQEFINVKLSDYIGKKYVVLFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSIDSFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKAFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQENPDEVCPAGWKPGERSMKPDPKGSKEYFAAI*

Retrieve as FASTA  
Remarks chromo 5
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTCCTTCGCCGCCGCGACCGTCGTCTCTTCCGCCCCCACCCCGGCCGCCAGGCCCCTCGCCGTTGCCCCGCAGTCCGTCTCTGTCTCCCGCTCCGCGGTCGCCACCGCCGCC
AGGCCGCTCCGCCTCGTCGCCTCCAGATCCGCGCGGGCCACCAGACTCGTCGCCCGCGCCGGCGGCGTC
GTAAGTTCTCCTCGCGTCTTGCCTGCTGCGGGCTTACTTCACACCCTCTCC
TAGTTTGCGCACTCACGGCTCATGCCCTTGTGCCTGTGCTACGTAGGATGACTTGCCGCTGGTCGGGAACAAGGCGCCAGACTTCGAAGCCGAGGCCGTGTTCGACCAAGAGTTCATCAA
C
GTATGTGCACCTCTCTCCACGCAATCTCGCGTGGTTTTATGCTGTGGCAGCAGAACTCTGAAATCTGTCATCAGTCATCCTTTCAAATTGCTCTTCCATTTGATGTGGCTGGCGGTGAC
ATTGCTCTGTGTGCTTTTGCAGGTGAAGCTCTCTGATTACATCGGGAAGAAATACGTCGTTCTGTTCTTCTACCCCTTGGATTTCACCTTTGTCTGCCCGACCGGTGAGGATAAAACAGT
AGCATAAGTATCAAGAAGATTCGTTTGGAGTGGATCTCTGAGATTCTGATGAACGAACGCCTGATGCTTGCAGAGATTACTGCCTTCAGTGACAGATATGAGGAATTCGAGAAGTTGAAC
ACTGAGGTTCTTGGTGTCTCTATTGACAGTGTG
GTATGATATAATGCCCTCATATTCCATGATATGGTAGCATCTATCAGTACGAATTAGTCATCAATTGTTCTATAGTTGACATCTGAT
ATCTCTACTGCTTGTGTGGATTGTTCTTTGTTCTATGTCGTAGTTAGCTCTTGAAGTACATTTCAGATTTGATATGTGCTAGGAGCCCATAACGGGAATATAATTATTATGGTTGAACTG
CTCCTGTGATGAGAAATTCACGTGCTACTGCTAGGTTGTCTTTGGAGCACAAGCACAACTGTATTTGTGTGCATGGTTCTTGACCATAGTCACATTATTTCTAAAGCTAATTCTGGAAAG
TATGTTCATGTGGAGTTAGGAAACAATAATTATACAAATACACAATGTTCTATAACAGTAGAACCGCACATGCCTTTTTTCCTTTACACTTGCCCATTTCAAGTTTTTTAGTAAAGTAGT
AGGGCCACACATGCTGATTTTTCCTCATGGTGAAAGATATGTGCCACACTTTACGAATGTAACTATTAATAGAAAAATCCATCTACATGAACATAAGAGCAGTGTCACTAGGGATGAAAA
CAATGAGAAAATGTTAAATTACAATATAGAGTCTGAAAGTAGTTGGTATAGGATTTTCCTGTTCATTGTACAAATAACTGAAAAACCGGTTGTGCTAAAATCACAAAATGACAACTTTCA
TGTTTTGATAGAAACGGAAACAGTATCATAATACGGAAAACGATATTGGTTGGTATGGGATTTTTATGTAATGCTTTCACCCCTACGGGCTATTTGGCAATTCCATTTTCCCAAGTGAAA
ATGAACTAATTTTCCTTGGGAAAATGGAAACCCCTTGGAAAAATGGGGTTGCCAAACTAGCCCTAAGTGACACATTACTATGTTAGATTCATTTTCGGATTTTATATCGGGACTAACTAC
TCACATTACACTTGAGGCCTTAAATTTAACCTTTGTTGGCACAAAGGAAATGTGTTCTAGCTTCATGGTCTTATTAAATTGACCGTTGCTCGCTAAAGTTCTTAACAAAGCTTTGGGAAA
TTGCGTACTTCCCTCCAATCGTAAACATATGACACCATTGACTTTTTACTCAAACTTTGACGAACAATATTATTTAATTACTTAGCTAAGTAAAGTGAAAAGCTAGATCTATCATCAATA
CTACTACCCTTGGATGTTTGTCTATTTGTGCAGATATTTATAGAAAAGACAAATCATCAACAACAACAACAACAAAAAAGTCTTTTAGTCCCAAGCAAGTTGGGGTATGCTAGAGTTGGG
TAGGCTAGACAAATAATCAAATGAATAAAAAGAGTCCATGGCTACATGGAAGGAGTACTATGAAGAATGGCCTGTATATTTGAAGTCTTTTTACAATTATGATTTGTTTTTACTCTCTTC
ATTCCAAATTGTAGGTCGCTTTGGTTTTTCTAATAGCTAGACATGGTGTATATCTAGGTGCATAACAAAAGCTATGTACCTAGAAAAGCCAAAACGACATATAGTTTGGGATGGAGAGAA
TAACTCTTTATATATCATTATATGTATGTGGTCAAAAGTAGAAATCTTAAACTACATGGATAATCAGTTTTGGTCACTGTGATTTCATCGGTATTATAACTCTTGATAATTGTTTTTGTT
TGACCATATCTTGACATTTGAATGACTCTTTGGATGCAGTTCTCCCACCTTGCATGGGTGCAGACAGACAGGAAGTCTGGTGGGCTTGGCGATCTTAAATACCCACTTATTTCTGATGTC
ACCAAATCAATTTCAAAGGCCTTCGGTGTTCTGATCCCTGACCAG
GTATTATTTCCAGCCACTGCATATTCTTCTCTAGATCCTTGCACTGTGGAGTCCTTTTGTTTTCCATGTGATGTT
TCTGTTAGTTGCTCCCTAAATCTGAATGTTCTTTGGGCAGGGTATCGCTCTGAGAGGACTGTTCATCATTGACAAGGAGGGAGTGATTCAGCACTCTACCATTAACAACCTTGCCATTGG
TCGCAGTGTGGACGAGACCATGAGGACCCTTCAG
GTATTTTCTATGTTGGCTGTGCTACATTTCTGATAGGAAGTTGATCTGGACTTTAGATATTAGAAGTTCTGTGCTGCTAGGGCTAG
TTCGGGAACCCTATTTTCCCACGGGATTTTCATTTTCCTAAGAGAAATTAGTTCATTTTCCATTGAGAAAATAGAAATCCCTTGGAAAAAATGTAGTTCCCAAACTAGCCCTTACTAAAA
CAAAAAAAAAAGTAAAAAGGAGATGCACTTTTGTATTCATGGTGTTTGTGATGCACAACTTGAACAAGATTTAACACTGGTGTGAGTTTTATTACATGTTTAACTGTTTTGTAACACTTG
ACAGTGCAACATAGTTCTCCATTTGCAGGAACAAAAACTATGTCCAACCTTTAAAGCACACTCTAATCCAAATGCTTCAAATTACAGAATAATTATTGAAACATATGTACATTAATTATG
TGACCTATTTTTTTTTTCTTGGCATTAGAGTACACGTGCATCATATTACAGGATTCCACTGTACTAAATATAACTGCCAAAGTACTACAGATACCAGTTTTCATATGGCAAGATGCATCC
TAGCAAGCATGACCAAGTGAGGCTCTTGATCTGGGAAGGCATTTTGTAGCTTCCCAATGAAAAACAATAAGCATAATCCCAATTTGCTGAGCTGGTTTACGCCCAACCCAGTTACATAGT
TGATTTTGCCATTTTATACAGTCCACCGATCAGAATGAAAAGAATGTTGAGGTTGACGTCTCATTTCAATGTTTCATCAGGCATTGCAGTACGTCCAGGAGAACCCAGACGAGGTCTGCC
CGGCCGGTTGGAAGCCAGGGGAGAGGTCCATGAAGCCCGACCCCAAGGGAAGCAAAGAGTACTTCGCGGCC
GTGTAGACTCGCCGTCTTTGAGAAGCTTTGCTACGTTTTTGTCATGGTG
CCCGCTAAGCCCCCCGGCAGTAGGTTGGAGTTTTGCGGAGCTCGCGTTTTTACAAATCTCTGTGCTCTGAACCGAGCGTAGTAGCCCCCCTTTGCTGTTGTGCATCCCGATTGAGTGCTG
TTCTTTGCCACCTTGTTTAATTTCGTCACCTGACGACATAAGGTTCATTTTACACGTGATTGAGAGATCTCACCTCTAGTCTTGTGTCGTAGTTTGTCGGAAAAATTCCCTATATATCTT
CACATTTTAAACTCATTCCTTACAAGGCCTTTTCTAGTTTATGTTTCTTTGGGGGGCACTTCCTGGCCCAAGCTGCTATGCAAAAAAACGCAAGGCCCGCCCACCAGGGGCCCATAACTT
AAACTCCTTCGCGCTGTTTTTGCTGGCCCGTAAGGCCTACTGCACTGTACACTTGGGGCTGCATTCATCAAGGACCCGCAGCAATCTTGATTCCATTCTCTGTTGTAGTGTTGTTAAATA
ATGGCGGTCCGGTGCAGATTATTTTTGGAGTTTAGGAGAGTAAAAGATAGTAGATTTTCAAAACATTTTGGTGTTTAGAAAACACACACGACCTCTTTGGGTGCAACAAGTTAAACCATC
GATAAATTAAAGTTGTATCTTTTTTAGGGATATATGGTCCTATTTCAGCTGTGTTCAGTTTCTGACCACTAGAAGCCGCTACAGACTACAAAATATCCACAAAATATCCATCTTTTCAGT
CCGCTTCTACAAAATATCCATCTTTTCAGTCCGTTTCTACAAGAATCACTTTAGTTAAAACCGTCCAAAATCAACGCGGATGAATCGTTGTGATAGTAGGAAATAATTACTTTCTACATT
CTAAACCCCATGAACACTTTTATTTTTCTTCACACGTAATCTTTATGATATTTAGATTCTCTTTGCAGAGGTCGGGAGATGATTTGTATCAAACTTTTAAATGCAATGAAAATCTTTCTT
ATCGAAAAAATAGATTCTCTTCACATACGGATTTTCTCGTAGCCAGATTCTTAAGAAATCTCTTAAAAAATTGAACCAAATAAGTCCCATATGTGATACTCCTTGGCAAAAAAAAAAAAA
CACCGAGCAGTCCTGCAAGTACATCCCTTTTTATGATTCTCTTCTCCCTGCTGGCTGGACACTCCTATACAGGGCACATGCTACAGGCATGATGCACTGAGCTAGCTAGGGGAAGGGACG
CGCTAGCTGCTGCTTGTGCAACGCCCCCTTCTTCCTCTTGGTTGCATTGTGCAACTAGATGCACGGACGCGCTTTCACCGGCAGCAATACATACTCACCTACATGCTTACGCACGACATC
GAGTGTGCATAGTTATTTAGCTATACACAGTTACACACACACACACATAAGTATCGGCCAATTCCCGCCACTCTCTAGTCTGTACGTAGCATGGTAAGAAAACAGATAGCATGCACTGTC
GTGTCTCGATCGATCTTGATCGAGCGTCCTGCTGCAGTAGCCACAACGGTTAGCATGCATGTTGCAGTAGCCACAGCGGTTGCAAAAGGGGTCAGACACACACACACACACACACAAAGC
GACTGCCGGAATGACCGTACGTAGAGACGAGTGAGAGCCGGAGGTCACGTTATACACCAGCGGGGCCGGCGGCCATTCAATTCTTTCCAAGTTCCCATGCCCTTCTCGACCTGCTTCTCC
AGTTCCCCTGCTCCTCATGACCACCACTATAATCCGAGGCGATATATAGCACGTATACGTAGTAGCATGCAAAAATCTGCCACGCGCACCCGCATGCGCGTGTTTACTATACATGCACAG
TACCAACGTCTCTGATATTCTTTCTGTGTGTGTGTGGTAGTGAGTGACTAGTGACTGACTGCAGTCAGGGTACTGTGCGCCTGCATGCCTGCGACCCCCTGCATGCACGCAGCACATTCA
TCAGGAGGATGGATGGAATGACCTGACATGGGGCTTTTGCTCGCCAGCACGTTCAGACAATCAGGCAGCCATCCAGGCAGCTGCTGCTAGCTGCTGCCACTGTTCCCTTGTAGTAGTAGT
GCTTCTCTTCTTATCGGAGTCAGGTCCAGGTCAGGTCGTCAGGTCAGGTCAGTTCAGGTAATTAGTTCAGGGCCGAGTACCATGCACTCTCCAAAACTCCATGGAGTAGTGTACGACGAC
CCTACTAAAACCCTGCCGCTTTTGGCCGGATAATGCCACCTAAGTGCTTTTTTTTATTAGCGCCCTCTCTTCTTTTCCTCTTTGCCGCCTTTGCTGCTCTCAACTCCCTTTGAACAGATT
AAGGCCGGCCGGGGCGGGGCGCCGGGCCCCTTGTTGGAACAGCGAAGGATGGGCCAAACTGATCTTGATCCATTTCATTGAAAGGCATTAATTATGAACCCCAAACCTATCGACAGGCTC
TCAGTCTCAGCTGCTTGTTCCGTTCTCTCTGCTTTTAATTTGTGATCGACCCTTAACCAACCAAAGAGGACTGCTACGACACACACAAAGGGCTAAGAGAGAGAAAGCCCCAGATCAGCA
TCTCTTTGCCTTGCATTGCTTTGCTCATATGATTCTATACATACTCTTTCGGTCTTTCCCCGCTCTCCCTTTAGAGCTAGTTTGGGAGCCACAAAACCAAAGAGGGTTAGAGAGGCTATA
ATCTCCTTTTTATTTAAAATTGAATAAGAAGGAGATTATAGCTCCTCCAATTCCCTCCGGTTTTTTAGCTACCAAAGTAGCTCTTAATTCTTTTTCAAATGCTTGTGTTTTTGTTGTGTC
ATTTTATTTTATTTTTAGCAACAATTACCCCCCCCCCCCCCCCCCTTCTGTTGCCTTTGTTTGCGTTTCTACTAGCAGTGTTACTTTCCCATGCAGCTCTCCTTTTCTGGCGGTTTTTTT
CCCGCCTTTGCAGAGCAGCCCGCTGCACTTTGCTATCATTAGGGCTTGTCCTCTTGCTGCCCTTTGGGCCCAAGCAAATTGTGGTGATGACCACAGCTTTTATTTCTTGACTGCGACTCT
CTGGATTAGTTTCCAAAGAGACATACCGGCCGGGAGACAGACCAATCTTATATTATATATTTACATCACATAGTAAAAAAAAAACCCTAAACTTCTTAGCACTCAGAAAAAGCTTTCTAC
AGATGGCCAAATGATGACGGCAGAACGAATTTACAGGGAAGTTCTTTTCAGTAAGAAATAAGTGAATTAAAAATGGTATATATGTGTAAGTAGTCATGATCATGGATGGTGCACATTTCT
TCACGTACGTATTTTGCATGCATGGTATGTAGTAGGTAGAGATGAGAGGAAGCCATAAGAGATGATTTATGGATATAATGACGCCGAGTTTCCTGAAAGTGACGACGACGACAGCAGATA
TAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTCCTTCGCCGCCGCGACCGTCGTCTCTTCCGCCCCCACCCCGGCCGCCAGGCCCCTCGCCGTTGCCCCGCAGTCCGTCTCTGTCTCCCGCTCCGCGGTCGCCACCGCCGCC
AGGCCGCTCCGCCTCGTCGCCTCCAGATCCGCGCGGGCCACCAGACTCGTCGCCCGCGCCGGCGGCGTC
GATGACTTGCCGCTGGTCGGGAACAAGGCGCCAGACTTCGAAGCCGAGGCC
GTGTTCGACCAAGAGTTCATCAAC
GTGAAGCTCTCTGATTACATCGGGAAGAAATACGTCGTTCTGTTCTTCTACCCCTTGGATTTCACCTTTGTCTGCCCGACCGAGATTACTGCCTTC
AGTGACAGATATGAGGAATTCGAGAAGTTGAACACTGAGGTTCTTGGTGTCTCTATTGACAGTGTG
TTCTCCCACCTTGCATGGGTGCAGACAGACAGGAAGTCTGGTGGGCTTGGCGAT
CTTAAATACCCACTTATTTCTGATGTCACCAAATCAATTTCAAAGGCCTTCGGTGTTCTGATCCCTGACCAG
GGTATCGCTCTGAGAGGACTGTTCATCATTGACAAGGAGGGAGTGATT
CAGCACTCTACCATTAACAACCTTGCCATTGGTCGCAGTGTGGACGAGACCATGAGGACCCTTCAG
GCATTGCAGTACGTCCAGGAGAACCCAGACGAGGTCTGCCCGGCCGGTTGGAAG
CCAGGGGAGAGGTCCATGAAGCCCGACCCCAAGGGAAGCAAAGAGTACTTCGCGGCC
ATATAG

Retrieve as FASTA