Entry information : AcoPrx09 (AcoGoldSmith_v1.007176m)
Entry ID 8573
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx09 (AcoGoldSmith_v1.007176m)
Name (synonym) AcoPrx09 (AcoGoldSmith_v1.007176m)
Class Class III peroxidase    [Orthogroup: Prx022]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx09
start..stop
S start..stop
AfpPrx04 751 0 1..365 1..365
AcoPrx05 538 0 1..363 1..365
AfpPrx02 509 0 56..363 8..311
AfpPrx11 484 8e-173 1..364 1..365
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1643274..1643585 312 N° 2 1643688..1643879 192 N° 3 1643959..1644124 166 N° 4 1644696..1645123 428
join(1643274..1643585,1643688..1643879,1643959..1644124,1644696..1645123)


exon

Literature and cross-references AcoPrx09 (AcoGoldSmith_v1.007176m)
DNA ref. Phytozome 12:   scaffold_20 (1643274..1645123)
Protein sequence: AcoPrx09 (AcoGoldSmith_v1.007176m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   366 (345)
PWM (Da):   %s   40171.1 (37847.8)  
PI (pH):   %s   5.23 (5.21) Peptide Signal:   %s   cut: 29 range:21-365
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MWEIARQLSVLVLTVSLLLSLGNQSGEQQKNDRFNSSRSSISWIHPIILSNKEVIDSTLEYDYYRDSCPQAEYIVRSSIRFLYKEQPNVAPALLRLLFHDCFIQGCDASVLLDSTIDGNQSEKDTVPNQTLKGFHVIENIKAEIEAVCPATVSCADILVLAARDGLVLAGGPYYPLTTGRRDSLVSFANIAASEVPSPQDDLSKTLTSFASKGFDERETVSLLGAHSVGVAHCQFFRSRLYNFSGTGLPDPSLEPEFLHLMRSRCQSSDDSKSHTEEPGMSMGYDGATGPVFGTNYYNTLVLGKGILHADQQLMAGEGTASWVEAYASDESLFRRDFAQVMMKLSSLRVLTKPLGQIRLNCSRVA*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGGAAATTGCAAGGCAACTAAGTGTTTTAGTACTTACAGTCTCTTTACTTCTCTCTCTTGGTAATCAAAGTGGTGAGCAACAAAAGAATGATAGATTCAATTCTTCAAGATCATCT
ATATCATGGATTCACCCAATAATTCTCTCAAATAAAGAAGTAATTGATTCTACTCTTGAATACGATTATTATCGAGATTCTTGCCCACAAGCTGAATACATTGTTCGATCATCCATTCGT
TTTCTTTATAAAGAACAACCTAATGTTGCTCCAGCTCTATTGCGTTTACTCTTCCATGATTGCTTCATTCAG
GTAAAATTTTGATTAGGGTTTTAAAGGGGTTTTGTTATTTTCCCCAAA
TTTCGATTAGGGTTTTTGTAATTTTGATTGGATTATTGCAAATTTGCAATGCAGGGATGTGATGCATCTGTTCTATTGGATTCTACCATTGATGGAAATCAATCAGAGAAGGACACTGTA
CCTAATCAGACTTTGAAAGGGTTTCATGTAATCGAAAATATCAAGGCAGAAATCGAAGCAGTGTGTCCTGCAACAGTTTCTTGTGCTGATATTCTTGTTCTTGCAGCTAGAGATGGACTT
GTTTTG
GTAATGTTTTGAGTAGTTTGATGTTTTTTTTCGCTTAATGGTTTTCGTCAATTTGCTTTTCTGATAGTTGTAATCATAGGCTGGTGGTCCTTACTATCCCCTAACTACTGGAAG
GAGAGACAGTCTTGTATCGTTTGCTAATATCGCGGCTTCGGAGGTACCTTCTCCTCAGGATGATCTTTCCAAGACCCTTACATCCTTTGCTAGTAAAGGATTTGATGAAAGGGAGACTGT
CAGTCTCTTAG
GTAAGCTGCCTGTTCTATCTTCTCTGAGCTTAATGAAATAATTCGATTAAGTTTGGTATCTTCTGTGTACTTTATATTACTCCGTAATAACATGCGCTTTACAATTCAG
CATTAAGTGAGAATAATATTTGATCATGTCTTCAGTTTTTCGACAAAAGAAATTACTATTGTTCATAACTTGTAAGTGAACTAAAATAAGTATTTGATTATTTTTAATCTGGCAATTGCT
AGTTGGATAAAAGTTGTTTTGCTGGTCAGGTTAAGGGTTTTTAACATTCTACACATTTGAGTTTTTGGCTGTAGCTATTTTTTTATTTTTCATAGTAAGTAATTTGTATACTCCTGTTGT
TAATGGAGCTAAAAATGCGCACTCGACTACAATTTTTCCTGTTTGTTAGTTATATCTTATAATGTTGATGACTACGGAGTAAATGAACATATCTGATCAAATTTATTTTCTAACACATTT
GGCAGTCTGTTTGCTAGAACAAAGTTAATATTTTACTGCTAGTTAATGGACATAAACTTACCTAAATATTACTTTTGGCAAACTGTAATGGTTATTCACCAGGTGCTCACAGTGTAGGAG
TAGCTCACTGCCAGTTCTTTCGCAGCCGCCTATACAATTTCTCAGGGACTGGCTTACCTGACCCATCACTTGAACCTGAATTTCTCCACCTGATGAGGTCAAGATGTCAATCATCTGATG
ACAGCAAGAGTCACACAGAGGAACCAGGGATGAGTATGGGCTATGATGGAGCAACAGGACCAGTGTTTGGTACAAATTACTACAATACGTTGGTGCTAGGAAAGGGTATTCTTCATGCTG
ATCAGCAGTTGATGGCTGGGGAAGGAACTGCAAGCTGGGTCGAAGCCTACGCATCAGATGAATCCCTGTTCCGAAGGGATTTTGCCCAAGTGATGATGAAGCTTTCAAGCCTTCGAGTCC
TGACAAAACCACTTGGACAGATCAGGCTCAATTGTTCGAGAGTTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGGAAATTGCAAGGCAACTAAGTGTTTTAGTACTTACAGTCTCTTTACTTCTCTCTCTTGGTAATCAAAGTGGTGAGCAACAAAAGAATGATAGATTCAATTCTTCAAGATCATCT
ATATCATGGATTCACCCAATAATTCTCTCAAATAAAGAAGTAATTGATTCTACTCTTGAATACGATTATTATCGAGATTCTTGCCCACAAGCTGAATACATTGTTCGATCATCCATTCGT
TTTCTTTATAAAGAACAACCTAATGTTGCTCCAGCTCTATTGCGTTTACTCTTCCATGATTGCTTCATTCAG
GGATGTGATGCATCTGTTCTATTGGATTCTACCATTGATGGAAATCAA
TCAGAGAAGGACACTGTACCTAATCAGACTTTGAAAGGGTTTCATGTAATCGAAAATATCAAGGCAGAAATCGAAGCAGTGTGTCCTGCAACAGTTTCTTGTGCTGATATTCTTGTTCTT
GCAGCTAGAGATGGACTTGTTTTG
GCTGGTGGTCCTTACTATCCCCTAACTACTGGAAGGAGAGACAGTCTTGTATCGTTTGCTAATATCGCGGCTTCGGAGGTACCTTCTCCTCAGGAT
GATCTTTCCAAGACCCTTACATCCTTTGCTAGTAAAGGATTTGATGAAAGGGAGACTGTCAGTCTCTTAG
GTGCTCACAGTGTAGGAGTAGCTCACTGCCAGTTCTTTCGCAGCCGCCTA
TACAATTTCTCAGGGACTGGCTTACCTGACCCATCACTTGAACCTGAATTTCTCCACCTGATGAGGTCAAGATGTCAATCATCTGATGACAGCAAGAGTCACACAGAGGAACCAGGGATG
AGTATGGGCTATGATGGAGCAACAGGACCAGTGTTTGGTACAAATTACTACAATACGTTGGTGCTAGGAAAGGGTATTCTTCATGCTGATCAGCAGTTGATGGCTGGGGAAGGAACTGCA
AGCTGGGTCGAAGCCTACGCATCAGATGAATCCCTGTTCCGAAGGGATTTTGCCCAAGTGATGATGAAGCTTTCAAGCCTTCGAGTCCTGACAAAACCACTTGGACAGATCAGGCTCAAT
TGTTCGAGAGTTGCTTGA

Retrieve as FASTA