Entry information : AcoPrx10 (AcoGoldSmith_v1.007568m)
Entry ID 8574
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx10 (AcoGoldSmith_v1.007568m)
Name (synonym) AcoPrx10 (AcoGoldSmith_v1.007568m)
Class Class III peroxidase    [Orthogroup: Prx116]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx10
start..stop
S start..stop
AcoPrx46 663 0 1..354 1..354
AfpPrx15 662 0 1..354 1..354
AcoPrx07 561 0 26..352 25..352
AfpPrx17 522 0 1..354 1..346
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3526974..3527222 249 N° 2 3527528..3527722 195 N° 3 3527806..3528426 621  
join(3526974..3527222,3527528..3527722,3527806..3528426)


exon

Literature and cross-references AcoPrx10 (AcoGoldSmith_v1.007568m)
DNA ref. Phytozome 12:   scaffold_23 (3526974..3528426)
Protein sequence: AcoPrx10 (AcoGoldSmith_v1.007568m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   355
PWM (Da):   %s   38243.26  
PI (pH):   %s   7.7
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSSSASFISLLLVSSFLLGSHLSLTSAQATPPLVAGLSYNFHATNCPSLETTIREYLREIFSSDFGVAAGLLRVHFHDCFVQGCDGSVLLAGSASGPGEQAAPPNLTLRPRAFVIINELRNRIHRACGAIVSCADITALCARDAVFLTGGPDYRVPLGRRDGVTFATRDDTLANLPFFGSRVPTLISDFARKNLDVTDLVALSGGHSIGRSNCGSFVGRLYPTRDPTLETNFANNLTRVCPTNTSSGLTALDVRTPNIFDNQYFVNLVNRQGLFVSDQDLFTDNTTRPIVVSYANNQSLFFQRLAFSMIKMSMINVTTGTRGEIRTNCSARNTATSYLSTAVIDEEQGKSASY*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCTTCTTCTGCTTCATTCATCTCTCTTCTCTTAGTATCTTCTTTTCTTCTTGGTTCTCATTTGTCTCTAACAAGTGCACAAGCCACACCTCCTTTGGTTGCAGGACTTTCATAT
AATTTCCATGCCACTAACTGTCCATCTTTAGAAACCACTATTAGAGAATACCTTAGGGAGATCTTCAGCAGTGATTTTGGTGTTGCTGCAGGTTTGCTTCGTGTTCATTTCCATGATTGC
TTTGTTCAG
GTACTTAGTTATCTTTGATTCATCATATCGTCTGTTTTTCATATGATTATATGTTGTTTAGGTAAAATACTTATTATATATGGTAAATGCTGTTGAATCTAATATATATAG
TTTAGTCAACATCAATGATCCAAAAAGGCTATATAATCATGAGTTTGGCAAGCTGACTTCATTTTTCACCAATTCACTTATTTGAACTGATTCATCGATATCTTACTGTTCGGATATATA
TATAACATAACATCTATATATAGTTACAATATGATTATTATTTGTGATTGATATATGTAGATGTTTATGGGCAGGGATGCGATGGCTCAGTGCTGCTAGCTGGGTCAGCAAGTGGTCCTG
GTGAACAAGCAGCACCACCAAACTTGACGTTGAGACCAAGAGCATTTGTTATCATCAATGAACTTCGTAACCGCATCCATAGAGCTTGTGGTGCAATCGTTTCATGTGCTGATATTACTG
CCCTTTGTGCTCGTGACGCTGTTTTTCTG
GTAACCTCACAACTGATGTCTTCTATTTAATTTGTCAACTCAATTGAAGAAATAAAAAACTAATTCGTGTTCGTGGTGTGCAGACTGGTGG
CCCAGATTACCGAGTTCCTCTAGGTAGGCGTGATGGGGTCACTTTCGCGACAAGAGATGACACACTAGCCAACCTACCATTTTTCGGTTCAAGGGTACCAACGCTTATTTCTGATTTTGC
CCGTAAGAACTTGGACGTAACTGATCTTGTTGCACTCTCTGGTGGTCACTCCATTGGCCGTTCAAACTGTGGTTCTTTTGTAGGACGATTGTACCCTACCCGAGACCCTACTCTGGAGAC
AAATTTCGCAAATAACCTTACGCGTGTTTGCCCCACAAACACTTCTTCTGGACTCACTGCTTTAGATGTTCGAACTCCCAATATATTCGACAATCAATACTTTGTCAATCTAGTGAATAG
ACAAGGCCTATTCGTCTCCGACCAAGACTTGTTCACTGACAATACTACCAGACCGATTGTCGTAAGTTACGCAAATAATCAATCTTTGTTTTTCCAAAGATTAGCATTTTCCATGATCAA
GATGAGTATGATAAATGTTACAACTGGAACACGAGGTGAGATACGTACTAATTGCTCAGCTCGCAATACTGCTACATCATATCTGTCAACTGCTGTGATCGATGAAGAACAAGGAAAGAG
TGCATCATACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCTTCTTCTGCTTCATTCATCTCTCTTCTCTTAGTATCTTCTTTTCTTCTTGGTTCTCATTTGTCTCTAACAAGTGCACAAGCCACACCTCCTTTGGTTGCAGGACTTTCATAT
AATTTCCATGCCACTAACTGTCCATCTTTAGAAACCACTATTAGAGAATACCTTAGGGAGATCTTCAGCAGTGATTTTGGTGTTGCTGCAGGTTTGCTTCGTGTTCATTTCCATGATTGC
TTTGTTCAG
GGATGCGATGGCTCAGTGCTGCTAGCTGGGTCAGCAAGTGGTCCTGGTGAACAAGCAGCACCACCAAACTTGACGTTGAGACCAAGAGCATTTGTTATCATCAATGAACTT
CGTAACCGCATCCATAGAGCTTGTGGTGCAATCGTTTCATGTGCTGATATTACTGCCCTTTGTGCTCGTGACGCTGTTTTTCTG
ACTGGTGGCCCAGATTACCGAGTTCCTCTAGGTAGG
CGTGATGGGGTCACTTTCGCGACAAGAGATGACACACTAGCCAACCTACCATTTTTCGGTTCAAGGGTACCAACGCTTATTTCTGATTTTGCCCGTAAGAACTTGGACGTAACTGATCTT
GTTGCACTCTCTGGTGGTCACTCCATTGGCCGTTCAAACTGTGGTTCTTTTGTAGGACGATTGTACCCTACCCGAGACCCTACTCTGGAGACAAATTTCGCAAATAACCTTACGCGTGTT
TGCCCCACAAACACTTCTTCTGGACTCACTGCTTTAGATGTTCGAACTCCCAATATATTCGACAATCAATACTTTGTCAATCTAGTGAATAGACAAGGCCTATTCGTCTCCGACCAAGAC
TTGTTCACTGACAATACTACCAGACCGATTGTCGTAAGTTACGCAAATAATCAATCTTTGTTTTTCCAAAGATTAGCATTTTCCATGATCAAGATGAGTATGATAAATGTTACAACTGGA
ACACGAGGTGAGATACGTACTAATTGCTCAGCTCGCAATACTGCTACATCATATCTGTCAACTGCTGTGATCGATGAAGAACAAGGAAAGAGTGCATCATACTAA

Retrieve as FASTA