Entry information : AcoPrx13 (AcoGoldSmith_v1.007617m)
Entry ID 8577
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx13 (AcoGoldSmith_v1.007617m)
Name (synonym) AcoPrx13 (AcoGoldSmith_v1.007617m)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx13
start..stop
S start..stop
AcoPrx11 493 1e-176 25..352 25..353
AfpPrx19 489 2e-175 27..352 27..353
AfpPrx26 489 2e-175 1..352 1..352
AcoPrx12 487 2e-174 1..352 1..352
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3555909..3556154 246 N° 2 3556495..3556689 195 N° 3 3557267..3557884 618  
join(3555909..3556154,3556495..3556689,3557267..3557884)


exon

Literature and cross-references AcoPrx13 (AcoGoldSmith_v1.007617m)
DNA ref. Phytozome 12:   scaffold_23 (3555909..3557884)
Protein sequence: AcoPrx13 (AcoGoldSmith_v1.007617m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   353 (325)
PWM (Da):   %s   39013.64 (36042.1)  
PI (pH):   %s   7.75 (7.74) Peptide Signal:   %s   cut: 28 range:28-352
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSFASFFSLLLISSLLLGSHLSLTSAQTSPPLVRGLSFDFHRSTCPRLERIIRDELNNAFRRDIGLAAALLRIHFHDCFVQGCDASVLLEGSVAGPGEQEAPPNLTLRPDAIRLLNDLRERVHRACGQVVSCSDITALAARDAVVLTGGPEYRVPLGRRDGHNFATREDTINNLPSPLATARQLIDSLRTKGLDPTDIVALSGGHTIGRSLCTSFTNRLYPNQDPTMDPGYAANLKRTCPRADSNGTTMLDVQTPNMFDNRYYINLRNRQGLLTSDQDLFMDSTTRPIVTRFAENQRFFFERFAFSMIKMGMLNVTTGTQGEIRANCSRRNPPRSTYLTTMLDEEGESAAF*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCCTTTGCTTCATTCTTCTCCCTTCTCTTAATCTCTTCTCTTCTTCTCGGTTCCCATTTATCTCTAACAAGTGCACAAACATCACCTCCTTTAGTAAGAGGACTTTCATTTGAT
TTCCATAGATCAACTTGTCCTAGGTTGGAAAGAATTATTAGAGATGAACTTAACAATGCTTTCAGGAGGGATATTGGTCTAGCTGCAGCATTGCTTCGTATCCATTTCCATGACTGCTTT
GTTCAG
GTACATTTTTTCGCTAATGTGCACCGTCATTTCTTAAGAATATTTCAACTTTTATGATAATTCATATTGACAAATAATATAGGTTTTCACTTAATTTCATCTTATCTACAACTA
CTAACCAGCACCGACATGAACCCTTTAATGTTACTTTGTACTCCAATGTGGTTTAGTCCATATCGATTCTCTGCATCCACATCACTTTGTGCCCAATTTAAGTAAATGATTTGAAATAAA
CATATCAACCTTTTAGATCATGAACGCAGGGTGTCCTTGGCGCTGCATGATTATGACTAAACAAAGTGTATATTAGTTTCTGATGTTAATATGTGACTATGCGTAGGGTTGTGATGCGTC
GGTGCTGTTGGAAGGGTCAGTAGCTGGTCCGGGCGAACAAGAAGCACCACCAAACTTAACACTCAGGCCGGACGCAATTAGGCTCCTCAACGACCTACGTGAACGTGTACATAGAGCATG
TGGGCAAGTTGTGTCTTGCTCAGACATTACTGCACTAGCTGCTCGTGATGCCGTCGTCTTG
GTAACACCATACCTTTGCAACTACTTACTTCTGTCTTCTTTGTTGAATTGTTCATCTTT
GTTGCTCAGAAGAGTTTTCTGTTGTGTTCATACATCAACTTTGAAAATGAAGAGTTTGCTGTTGATTATGATATGGACATTAACCCTCTTACAATAAAACCAAAAAACAAAAAAATGGTC
AACAAATTGCTTTGACAGTACATCACTAACTTATTTGACTGTTTGCTACTACTACATGACAATATCTCACGCAAGCAAAATTCATATCAAAGAGACAATATACAGAAGACGCAGACAAAA
AAATTCTGTTCTATTCTAAAACAAAAGTTCAGGTGGCATATTTACTGCTTGGTTGACAAATAAATCACATGATTCTATTTTAATTTCTTCAGGAAACCTGACTAAAAATGTCTCCAAGCA
CAAGGACACAAATCCACTAGTCGAGATTCGCGTCTTTTTCAAATGACTGAAACGGATCTCGACTAGTCCATCTATATCGATGTCTAAAAGGATACAATTTACGTATGCCTTACAGGAAAT
TCTATTTTGTAACGTTCAATTTATGTTATGTGCTGCAGACTGGAGGTCCAGAGTACCGAGTTCCTCTAGGCAGACGTGACGGGCACAATTTTGCAACAAGAGAAGACACAATCAACAACC
TTCCTTCCCCGCTTGCAACTGCAAGGCAGCTCATTGACTCTCTGCGCACCAAAGGCTTGGATCCAACTGATATCGTTGCATTATCTGGAGGACATACTATAGGCAGAAGCCTCTGTACGT
CATTTACAAATCGCTTGTACCCCAACCAAGACCCAACTATGGACCCAGGTTATGCAGCAAACCTTAAACGCACTTGCCCGAGAGCCGACTCCAATGGCACTACCATGTTAGATGTTCAAA
CTCCTAACATGTTCGACAACAGGTACTATATTAATTTAAGGAATCGACAAGGTCTCTTAACATCCGACCAAGACTTGTTCATGGATAGTACTACTCGACCAATTGTCACAAGGTTTGCTG
AGAACCAACGTTTCTTTTTCGAAAGGTTTGCATTTTCCATGATAAAGATGGGTATGTTGAATGTGACAACTGGGACACAGGGTGAGATACGTGCCAACTGCTCGCGTCGCAATCCTCCTC
GTTCAACGTACTTGACAACTATGTTGGATGAAGAGGGAGAAAGTGCAGCATTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCCTTTGCTTCATTCTTCTCCCTTCTCTTAATCTCTTCTCTTCTTCTCGGTTCCCATTTATCTCTAACAAGTGCACAAACATCACCTCCTTTAGTAAGAGGACTTTCATTTGAT
TTCCATAGATCAACTTGTCCTAGGTTGGAAAGAATTATTAGAGATGAACTTAACAATGCTTTCAGGAGGGATATTGGTCTAGCTGCAGCATTGCTTCGTATCCATTTCCATGACTGCTTT
GTTCAG
GGTTGTGATGCGTCGGTGCTGTTGGAAGGGTCAGTAGCTGGTCCGGGCGAACAAGAAGCACCACCAAACTTAACACTCAGGCCGGACGCAATTAGGCTCCTCAACGACCTACGT
GAACGTGTACATAGAGCATGTGGGCAAGTTGTGTCTTGCTCAGACATTACTGCACTAGCTGCTCGTGATGCCGTCGTCTTG
ACTGGAGGTCCAGAGTACCGAGTTCCTCTAGGCAGACGT
GACGGGCACAATTTTGCAACAAGAGAAGACACAATCAACAACCTTCCTTCCCCGCTTGCAACTGCAAGGCAGCTCATTGACTCTCTGCGCACCAAAGGCTTGGATCCAACTGATATCGTT
GCATTATCTGGAGGACATACTATAGGCAGAAGCCTCTGTACGTCATTTACAAATCGCTTGTACCCCAACCAAGACCCAACTATGGACCCAGGTTATGCAGCAAACCTTAAACGCACTTGC
CCGAGAGCCGACTCCAATGGCACTACCATGTTAGATGTTCAAACTCCTAACATGTTCGACAACAGGTACTATATTAATTTAAGGAATCGACAAGGTCTCTTAACATCCGACCAAGACTTG
TTCATGGATAGTACTACTCGACCAATTGTCACAAGGTTTGCTGAGAACCAACGTTTCTTTTTCGAAAGGTTTGCATTTTCCATGATAAAGATGGGTATGTTGAATGTGACAACTGGGACA
CAGGGTGAGATACGTGCCAACTGCTCGCGTCGCAATCCTCCTCGTTCAACGTACTTGACAACTATGTTGGATGAAGAGGGAGAAAGTGCAGCATTTTAA

Retrieve as FASTA