Entry information : AcoPrx18 (AcoGoldSmith_v1.008147m)
Entry ID 8581
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx18 (AcoGoldSmith_v1.008147m)
Name (synonym) AcoPrx18 (AcoGoldSmith_v1.008147m)
Class Class III peroxidase    [Orthogroup: Prx046]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx18
start..stop
S start..stop
AfpPrx06 689 0 1..334 1..334
PpePrx23 458 2e-163 3..333 1..333
PtPrx83 450 2e-160 23..333 28..338
VvPrx15 449 4e-160 1..332 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1105612..1105830 219 N° 2 1105996..1106187 192 N° 3 1106303..1106468 166 N° 4 1106637..1107064 428
join(1105612..1105830,1105996..1106187,1106303..1106468,1106637..1107064)


exon

Literature and cross-references AcoPrx18 (AcoGoldSmith_v1.008147m)
DNA ref. Phytozome 12:   scaffold_44 (1105612..1107064)
Protein sequence: AcoPrx18 (AcoGoldSmith_v1.008147m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (314)
PWM (Da):   %s   37376.3 (34913.0)  
PI (pH):   %s   8.78 (8.72) Peptide Signal:   %s   cut: 21 range:21-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNMGKMSLILLVFICNRIEALNFNDGNLLPHYYKHSCPHAEKIVRRNVEIAVLKDPRMAASLLRLHFHDCFVMGCDASVLLDNSVAFLSEKQAVPNLNSLRGFEVIDRIKAILEEACPKIVSCADLLAIAARDAVTLRGGPSWKVYLGRKDSLKASLIGANQFLPAPNSSLETLISNFAVQGLDIGDLVALSGSHTIGKSRCTSFKERIYSRSIDYEGHHYKRNTVFHRILRTICPKSGRRDDAVVPLDLTTSARFDNRYYHNLIQGKGLLTSDNVLMSQDVEGKIVKQVWAYASDEQLFFRSFVESMLKMGNINVLTGGEGEIRHNCRVVNTW*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATATGGGTAAGATGTCTCTTATATTGTTAGTGTTCATCTGCAACAGAATTGAGGCTTTGAACTTCAATGATGGAAACCTTCTTCCACATTACTACAAACATTCATGCCCGCATGCA
GAGAAGATAGTTAGGCGTAATGTTGAGATTGCAGTGCTTAAAGATCCTCGAATGGCAGCTTCCCTTCTTCGCCTACACTTTCATGATTGCTTTGTTATG
GTTTAGCTCTCTACTTCTTCA
TTATTGTGCAATTATATTTATCTGTCGTTAGAACTGTGATATAATGAAATTTACATATCTGTCTTGGAATTCTTGTACAGAGGATTTAAGCCAGCTTAACCCTCAAAACTAATCCATCTG
TTACTTATTTGATTATCTGGTTAGGGGTGTGATGCATCAGTTCTTTTGGACAACAGTGTTGCCTTCTTGAGTGAGAAGCAGGCTGTGCCAAACTTGAACTCCTTAAGAGGGTTCGAGGTC
ATTGACAGGATCAAGGCCATTTTGGAGGAAGCATGCCCTAAGATTGTGTCATGTGCAGATCTTCTTGCTATTGCTGCTCGAGATGCCGTTACACTG
GTAATATATATTTTATCCTAGCTA
TTAATAAAGCCTCATTCATAATCATCAACCTTTTTGTTATACATGTTGTTTACATTCATTGCCAAAACTCAAATTTGCATTTCATCTACAGAGAGGTGGCCCAAGTTGGAAAGTTTATCT
GGGTAGGAAGGATTCTCTTAAGGCAAGCTTAATTGGTGCTAACCAGTTCCTTCCGGCACCAAACTCGTCGCTGGAGACTTTAATTTCAAACTTTGCAGTCCAAGGTCTTGACATAGGAGA
CTTAGTTGCGTTATCAG
GTAATACAACTGTCGATCGACATAACAATATATACTAGTTTCATTTATTGTAGATGGAATGGAACATTATATTAGCCAACCTCTAACATTAGGTATATAACCA
TGTCATTGCTATAAATAATGTTAAGAAAAAATCTGACATTTTGCTAATTAACATAATATCACCAGGTAGTCATACTATAGGAAAGTCGAGGTGCACAAGCTTCAAGGAAAGGATTTACAG
TAGAAGCATAGACTATGAAGGGCATCACTATAAGCGCAACACTGTCTTCCATAGAATATTAAGGACTATTTGTCCAAAATCGGGAAGAAGAGACGATGCGGTAGTTCCACTTGATTTGAC
TACTTCTGCAAGATTTGATAACCGATACTATCACAACCTTATTCAAGGCAAGGGTTTGCTAACAAGTGACAACGTTCTGATGTCTCAGGATGTTGAAGGCAAAATAGTGAAGCAAGTGTG
GGCTTATGCCTCTGATGAACAACTTTTCTTTAGATCGTTTGTTGAATCGATGCTGAAAATGGGAAATATCAATGTACTTACTGGTGGTGAGGGAGAAATCAGGCATAACTGTCGAGTAGT
AAACACATGGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATATGGGTAAGATGTCTCTTATATTGTTAGTGTTCATCTGCAACAGAATTGAGGCTTTGAACTTCAATGATGGAAACCTTCTTCCACATTACTACAAACATTCATGCCCGCATGCA
GAGAAGATAGTTAGGCGTAATGTTGAGATTGCAGTGCTTAAAGATCCTCGAATGGCAGCTTCCCTTCTTCGCCTACACTTTCATGATTGCTTTGTTATG
GGGTGTGATGCATCAGTTCTT
TTGGACAACAGTGTTGCCTTCTTGAGTGAGAAGCAGGCTGTGCCAAACTTGAACTCCTTAAGAGGGTTCGAGGTCATTGACAGGATCAAGGCCATTTTGGAGGAAGCATGCCCTAAGATT
GTGTCATGTGCAGATCTTCTTGCTATTGCTGCTCGAGATGCCGTTACACTG
AGAGGTGGCCCAAGTTGGAAAGTTTATCTGGGTAGGAAGGATTCTCTTAAGGCAAGCTTAATTGGTGCT
AACCAGTTCCTTCCGGCACCAAACTCGTCGCTGGAGACTTTAATTTCAAACTTTGCAGTCCAAGGTCTTGACATAGGAGACTTAGTTGCGTTATCAG
GTAGTCATACTATAGGAAAGTCG
AGGTGCACAAGCTTCAAGGAAAGGATTTACAGTAGAAGCATAGACTATGAAGGGCATCACTATAAGCGCAACACTGTCTTCCATAGAATATTAAGGACTATTTGTCCAAAATCGGGAAGA
AGAGACGATGCGGTAGTTCCACTTGATTTGACTACTTCTGCAAGATTTGATAACCGATACTATCACAACCTTATTCAAGGCAAGGGTTTGCTAACAAGTGACAACGTTCTGATGTCTCAG
GATGTTGAAGGCAAAATAGTGAAGCAAGTGTGGGCTTATGCCTCTGATGAACAACTTTTCTTTAGATCGTTTGTTGAATCGATGCTGAAAATGGGAAATATCAATGTACTTACTGGTGGT
GAGGGAGAAATCAGGCATAACTGTCGAGTAGTAAACACATGGTAA

Retrieve as FASTA