Entry information : AcoPrx20 (AcoGoldSmith_v1.008199m)
Entry ID 8582
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx20 (AcoGoldSmith_v1.008199m)
Name (synonym) AcoPrx20 (AcoGoldSmith_v1.008199m)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx20
start..stop
S start..stop
AfpPrx08 687 0 1..332 1..332
RcPrx17 594 0 1..330 1..330
CclPrx35 580 0 1..330 1..330
CsPrx10 579 0 1..330 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2656820..2657044 225 N° 2 2657399..2657590 192 N° 3 2657667..2657832 166 N° 4 2657927..2658342 416
join(2656820..2657044,2657399..2657590,2657667..2657832,2657927..2658342)


exon

Literature and cross-references AcoPrx20 (AcoGoldSmith_v1.008199m)
DNA ref. Phytozome 12:   scaffold_7 (2656820..2658342)
Protein sequence: AcoPrx20 (AcoGoldSmith_v1.008199m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (310)
PWM (Da):   %s   36271.37 (33795.1)  
PI (pH):   %s   9.49 (9.48) Peptide Signal:   %s   cut: 28 range:23-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVSMTTFMLFSVLVFAPLCLSHKSNGGYLYPQYYDHSCPKALEIVKSVVAKAVAKETRMAASLLRLHFHDCFVKGCDASVLLDNSSNIISEKGSNPNRNSARGFEVIDDIKSALEKECPGTVSCADALALAARDSTVLAGGPTWDVPLGRKDSKGASISGSNNMIPAPNNTFQTILTKFKLQGLNVVDLVALSGSHTIGNSRCTSFRQRLYNQSGNGQPDYSLDRSYAAQLRKNCPRSGGDQNLFFLDFVSPTKFDNFYFKNILASKGLLSSDQILLTKSSASMDLVKKYAENNELFFEQFAKSMVKMGNITPLTGSRGEIRKTCRKINKS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTCTCAATGACCACTTTCATGCTTTTTTCTGTACTTGTTTTTGCTCCACTTTGCTTATCTCATAAGAGCAATGGTGGTTACCTCTACCCACAATACTATGATCATTCTTGCCCA
AAAGCTCTTGAGATTGTTAAGTCTGTAGTTGCAAAAGCTGTCGCTAAAGAAACTCGAATGGCGGCTTCTTTGCTTAGGCTCCATTTCCATGACTGTTTTGTCAAG
GTCTGATCATCCCTT
ACATCCCTCCATACCTTTTCCTTAGCTTGTGTCACATAATCTTTAAGTTAATCATTTGATCATTGCCAAAAAACTATGATCAATATCCCTTTTACTTTTGTTAATCTGTTTTATTAGTTT
GCCATTTTCATAAACTAAAATTTATGCTTTCTCAAAAGCACTAAATAGTCTTTGTCATTTGAGTAGTGATGAAATAAAATAATGAAACTGTTAAATTATAGTTAGAATTGGAGTTATTTC
TGAATTTTGTCATCTTAAACAAGTATTATAGTTTCATTACTATGCTATAATTATTATTTCTTATGTCTTCCGTGACAAATGTTTTGTTTTCAACTGTAGGGTTGTGATGCCTCCGTATTG
CTAGACAACAGTAGCAACATAATTAGTGAGAAGGGGTCTAATCCAAACCGAAACTCAGCTCGTGGATTTGAAGTCATCGACGACATAAAATCAGCTCTAGAGAAGGAATGTCCGGGCACA
GTCTCTTGTGCCGATGCTCTGGCTCTAGCTGCTAGAGATTCTACTGTTTTG
GTACAAAATCTTAACTTCTTCAGTGTTGAAGCCTTAATTGTATCAGACTAGCTTAATGGTAATGTTTTG
TGTGTAGGCTGGTGGTCCTACTTGGGATGTTCCATTGGGAAGAAAAGACTCAAAAGGTGCAAGCATAAGTGGCTCTAACAATATGATTCCAGCACCAAACAATACATTCCAGACCATCCT
CACTAAATTCAAGCTGCAAGGTCTTAATGTCGTCGATCTCGTTGCACTCTCTG
GTATGTTTATGTCATGGCCCAAATTATTAGAAGTGAAACAAATAACCATAGGGAGTTTAATCATGTA
TATTGTTCATGTTGTACCCCCATGCAGGAAGTCATACCATTGGAAATTCAAGATGTACCAGCTTCAGGCAGAGACTGTACAATCAATCAGGCAATGGACAACCCGATTACTCTCTAGATC
GATCGTATGCCGCCCAATTGAGGAAAAATTGTCCACGATCCGGTGGTGATCAAAATCTATTCTTCTTGGACTTTGTTTCACCTACAAAATTTGATAACTTCTACTTCAAGAACATTTTAG
CTTCAAAAGGCCTACTAAGTTCAGATCAAATTCTGTTGACAAAGAGCAGTGCATCAATGGATTTAGTGAAGAAATATGCAGAGAACAATGAGCTTTTCTTTGAGCAATTTGCTAAATCTA
TGGTCAAGATGGGTAACATTACTCCTTTGACTGGTTCCAGAGGAGAAATCAGAAAGACTTGTAGGAAGATTAACAAGAGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTCTCAATGACCACTTTCATGCTTTTTTCTGTACTTGTTTTTGCTCCACTTTGCTTATCTCATAAGAGCAATGGTGGTTACCTCTACCCACAATACTATGATCATTCTTGCCCA
AAAGCTCTTGAGATTGTTAAGTCTGTAGTTGCAAAAGCTGTCGCTAAAGAAACTCGAATGGCGGCTTCTTTGCTTAGGCTCCATTTCCATGACTGTTTTGTCAAG
GGTTGTGATGCCTCC
GTATTGCTAGACAACAGTAGCAACATAATTAGTGAGAAGGGGTCTAATCCAAACCGAAACTCAGCTCGTGGATTTGAAGTCATCGACGACATAAAATCAGCTCTAGAGAAGGAATGTCCG
GGCACAGTCTCTTGTGCCGATGCTCTGGCTCTAGCTGCTAGAGATTCTACTGTTTTG
GCTGGTGGTCCTACTTGGGATGTTCCATTGGGAAGAAAAGACTCAAAAGGTGCAAGCATAAGT
GGCTCTAACAATATGATTCCAGCACCAAACAATACATTCCAGACCATCCTCACTAAATTCAAGCTGCAAGGTCTTAATGTCGTCGATCTCGTTGCACTCTCTG
GAAGTCATACCATTGGA
AATTCAAGATGTACCAGCTTCAGGCAGAGACTGTACAATCAATCAGGCAATGGACAACCCGATTACTCTCTAGATCGATCGTATGCCGCCCAATTGAGGAAAAATTGTCCACGATCCGGT
GGTGATCAAAATCTATTCTTCTTGGACTTTGTTTCACCTACAAAATTTGATAACTTCTACTTCAAGAACATTTTAGCTTCAAAAGGCCTACTAAGTTCAGATCAAATTCTGTTGACAAAG
AGCAGTGCATCAATGGATTTAGTGAAGAAATATGCAGAGAACAATGAGCTTTTCTTTGAGCAATTTGCTAAATCTATGGTCAAGATGGGTAACATTACTCCTTTGACTGGTTCCAGAGGA
GAAATCAGAAAGACTTGTAGGAAGATTAACAAGAGTTAA

Retrieve as FASTA