Entry information : AcoPrx22 (AcoGoldSmith_v1.008216m)
Entry ID 8583
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx22 (AcoGoldSmith_v1.008216m)
Name (synonym) AcoPrx22 (AcoGoldSmith_v1.008216m)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx22
start..stop
S start..stop
AfpPrx16 689 0 1..332 1..332
LcPrx03 579 0 1..330 1..331
RcPrx17 574 0 1..330 1..330
CclPrx35 571 0 1..330 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3796958..3797182 225 N° 2 3797358..3797549 192 N° 3 3797653..3797818 166 N° 4 3797970..3798385 416
join(3796958..3797182,3797358..3797549,3797653..3797818,3797970..3798385)


exon

Literature and cross-references AcoPrx22 (AcoGoldSmith_v1.008216m)
DNA ref. Phytozome 12:   scaffold_10 (3796958..3798385)
Protein sequence: AcoPrx22 (AcoGoldSmith_v1.008216m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (310)
PWM (Da):   %s   36543.29 (33979.1)  
PI (pH):   %s   8.31 (8.20) Peptide Signal:   %s   cut: 23 range:23-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPPMSFFMVLSILAFAPLCFSDNINGGYLYPQFYEHSCPKAQEIIKSVVAKAVEEDARMAASLLRLHFHDCFVQGCDASVLLDSSGTIISEKRSNPNRDSLRGYEVIDEIKSALEKECPHTVSCADIAAVAARDSTVLVGGQGWEVPLGRRDSRGASLSGSNNNIPAPNNTFQTILTKFKRQGLDIVDLVALSGSHTVGNSRCTSFRQRLYNQSGNGQPDFSLDQSYAAQLRTRCPRSGGDQNLFNLDFVTPTKFDNSYFKNLLASKGLLSSDQVLLTKSEASMELVKKYAMNNELFLDQFAKSMVKMGNISPLTGSRGEIRNRCRVVNKY*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTCCAATGAGTTTTTTCATGGTTCTTTCCATCCTTGCCTTTGCTCCACTTTGCTTTTCTGATAACATCAATGGAGGCTACCTATACCCCCAGTTTTATGAACACTCTTGTCCT
AAAGCACAAGAAATCATTAAGTCTGTCGTTGCAAAAGCTGTTGAGGAAGACGCTCGAATGGCGGCTTCACTTCTTAGGCTTCATTTCCATGACTGCTTTGTCCAG
GTTAGTACAATATAA
CATACTCAAAATGTCGCAAAATACAGGCCGGGGAATGTCCTTTATTATAATGTTAGCAGTACTGCAGTAGTATATATGTCTCCTGCAAGGTTTATGTTAATACTGGTTGAATGGGTTTTG
TGTTTTACTGAAGCTCTATTATTTATCTTTTGGACCATAGGGATGTGATGCATCAGTGTTGTTAGATAGCAGTGGTACCATAATCAGTGAGAAGCGGTCAAACCCCAACCGAGATTCACT
GCGAGGATATGAAGTGATTGACGAGATAAAATCTGCGTTGGAGAAGGAGTGCCCACATACCGTCTCTTGTGCAGATATAGCTGCTGTTGCTGCAAGAGATTCTACTGTTCTG
GTATGTAT
TCAAAGCTCTATATCCAGATTGATTTTACAATGAATTTTTCCATTACTGAATGATCACTTGACAAGTAGTTAATATATATGTAATGTATAATTAGGTTGGGGGTCAAGGATGGGAGGTCC
CATTGGGAAGAAGAGACTCAAGAGGTGCAAGCTTAAGTGGTTCTAATAATAACATTCCCGCGCCAAACAACACATTCCAGACTATCCTCACTAAGTTCAAGCGGCAGGGTCTTGACATTG
TTGATCTTGTTGCACTCTCTG
GTATAATATATTTGAACTTTGGTTTCCTCTATTTCTTCACTTGCATAATCAAAAAAATTCAGAATTAATAGGATCAAACTTTCGAAACTTTGACTGGAT
TAATTTATCCATGATTTTTTACTACTAAATACTAACCCCCATACACATCCAGGGAGCCACACCGTAGGCAATTCTAGATGCACAAGCTTCAGGCAGAGGTTGTACAACCAATCTGGCAAT
GGGCAACCAGATTTTTCACTCGATCAATCCTATGCTGCACAGCTGCGAACTCGCTGCCCAAGGTCTGGTGGTGACCAGAATCTCTTTAACTTAGACTTTGTTACCCCAACAAAGTTCGAT
AACTCCTACTTCAAGAACCTTTTAGCTTCGAAGGGACTGTTGAGCTCTGATCAAGTCCTTCTAACAAAAAGTGAAGCATCAATGGAATTAGTGAAGAAATATGCCATGAACAATGAACTT
TTCTTGGATCAGTTTGCCAAGTCTATGGTAAAGATGGGAAATATCTCTCCATTGACAGGATCAAGAGGGGAGATCAGAAACCGCTGCAGGGTGGTTAATAAATATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTCCAATGAGTTTTTTCATGGTTCTTTCCATCCTTGCCTTTGCTCCACTTTGCTTTTCTGATAACATCAATGGAGGCTACCTATACCCCCAGTTTTATGAACACTCTTGTCCT
AAAGCACAAGAAATCATTAAGTCTGTCGTTGCAAAAGCTGTTGAGGAAGACGCTCGAATGGCGGCTTCACTTCTTAGGCTTCATTTCCATGACTGCTTTGTCCAG
GGATGTGATGCATCA
GTGTTGTTAGATAGCAGTGGTACCATAATCAGTGAGAAGCGGTCAAACCCCAACCGAGATTCACTGCGAGGATATGAAGTGATTGACGAGATAAAATCTGCGTTGGAGAAGGAGTGCCCA
CATACCGTCTCTTGTGCAGATATAGCTGCTGTTGCTGCAAGAGATTCTACTGTTCTG
GTTGGGGGTCAAGGATGGGAGGTCCCATTGGGAAGAAGAGACTCAAGAGGTGCAAGCTTAAGT
GGTTCTAATAATAACATTCCCGCGCCAAACAACACATTCCAGACTATCCTCACTAAGTTCAAGCGGCAGGGTCTTGACATTGTTGATCTTGTTGCACTCTCTG
GGAGCCACACCGTAGGC
AATTCTAGATGCACAAGCTTCAGGCAGAGGTTGTACAACCAATCTGGCAATGGGCAACCAGATTTTTCACTCGATCAATCCTATGCTGCACAGCTGCGAACTCGCTGCCCAAGGTCTGGT
GGTGACCAGAATCTCTTTAACTTAGACTTTGTTACCCCAACAAAGTTCGATAACTCCTACTTCAAGAACCTTTTAGCTTCGAAGGGACTGTTGAGCTCTGATCAAGTCCTTCTAACAAAA
AGTGAAGCATCAATGGAATTAGTGAAGAAATATGCCATGAACAATGAACTTTTCTTGGATCAGTTTGCCAAGTCTATGGTAAAGATGGGAAATATCTCTCCATTGACAGGATCAAGAGGG
GAGATCAGAAACCGCTGCAGGGTGGTTAATAAATATTAA

Retrieve as FASTA