Entry information : AcoPrx27 (AcoGoldSmith_v1.008340m)
Entry ID 8584
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx27 (AcoGoldSmith_v1.008340m)
Name (synonym) AcoPrx27 (AcoGoldSmith_v1.008340m)
Class Class III peroxidase    [Orthogroup: Prx021]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx27
start..stop
S start..stop
NtPrx31-1A 497 3e-179 1..328 1..327
CroPrx13 479 2e-172 10..328 4..321
EgrPrx124 476 6e-171 9..328 8..325
CclPrx59 474 4e-170 9..328 12..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1802167..1802385 219 N° 2 1801610..1801801 192 N° 3 1801307..1801472 166 N° 4 1800475..1800884 410
complement(join(1800475..1800884,1801307..1801472,1801610..1801801,1802167..1802 385))


exon

Literature and cross-references AcoPrx27 (AcoGoldSmith_v1.008340m)
DNA ref. Phytozome 12:   scaffold_10 (1802385..1800475)
Protein sequence: AcoPrx27 (AcoGoldSmith_v1.008340m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (302)
PWM (Da):   %s   35592.58 (32473.1)  
PI (pH):   %s   6.34 (6.12) Peptide Signal:   %s   cut: 27 range:27-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNHNQTIQSTFSLVCLFFFTSPLVFCQLDYSFYDDTCPNLSKIVTYAVSSAIANETRMAASLIRLHFHDCIVNGCDGSVLLDDTSSLRGEKGAGANQNSARGFEIIDDIKANVEEACPSTVSCTDILTLAARDAVYLAGGSYYYVPLGRRDATTASLSAANEQIPAPFESLRNITAKFTSKGLDAKDVVVLSGAHTIGFAQCFTFKDRLFNFNGSNQPDPALHTSLLKNLQSQCPNQDSSNSNLAPLDPVTINKFDNVYYKNILNKSGLLQSDQALMGDATSASLVNKYSKYPYLFSKDFGASMVKMANIGVLTGQTGEIRKNCRVAN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATCATAACCAGACTATTCAGTCAACTTTCTCCTTGGTTTGCCTTTTCTTTTTCACAAGTCCTCTCGTCTTCTGCCAACTTGATTATAGTTTTTATGATGACACTTGCCCTAATCTG
TCAAAAATTGTCACATACGCTGTGTCTTCTGCGATTGCAAATGAAACTAGGATGGCAGCCTCTCTCATCCGGTTGCACTTTCACGACTGTATCGTGAAT
GTAATTTTCTTCATCATTACC
CTTTATATTTTTATTATTGAGTAATTGCAAAACATGAGCCTACATTTAAAACAGTCAGTAATATATGCATTATGGATACCTTCATAAACTCATATATATTAATATTCAAATCAATATGAT
AATTACTTTCGGATAAGAAAACAAAATTTCATTTGGTGAAAGATTTAGTAACAATAACACCAAGTCACCAACACACTTCCTAAGCATCTGTAAATCTATTTGAAAGAACTGTATTCCTAG
CTTTAGCAGCTGAAAATCTGAAATAAAACCCTAGTATTTGAATGTAAGCGCTTGTTCTTTAAAAATATACTGCTGTTATATTGGTTTTTGTTTCCTTTGAGTAGGGATGTGATGGATCTG
TACTACTTGACGATACAAGCTCTTTGAGAGGGGAGAAAGGTGCTGGAGCGAACCAAAATTCAGCTAGAGGATTCGAAATAATTGATGACATTAAGGCTAATGTGGAAGAAGCCTGCCCAT
CAACTGTATCCTGCACAGATATTTTAACTCTTGCAGCAAGAGACGCGGTTTATCTT
GTAAGCATCAATGATTCACCATTTTCTGATGATTTATGCTAATTACTATTCTTTGTGAATCATG
TCGATGAAGCCTTCAAGAAACAATAAACCTAAAGTTATGGTGTTTCTGATTATAATCTTTCTCTTTTTTCTAGGCTGGAGGGTCTTATTATTATGTACCCTTAGGCAGGCGAGATGCCAC
AACAGCAAGTTTAAGTGCAGCTAATGAGCAGATACCAGCCCCTTTTGAGTCGTTAAGGAATATCACTGCAAAGTTTACCTCAAAGGGTCTTGATGCGAAGGATGTGGTCGTGCTCTCTG
G
TTTGCACCTTTCATTACATCATTTTAACTTTATCTTTAGCATCATACAACATTAAAAGAAATGGAAATCCTCATCTCAAGTGAAAATCTGTGACAGAAATAAACGAAGCCAGCAAGAACC
CTGGACTATACCCATCAAAACAAAGAACACTTTTCATTTTTGTAGACCTTTTCATGAAAACAGAAACAGCATTGTCTCTCATGCCAAGCTTAAATCCTATGTTGAGGTCTACTTTTAGGA
ATCATATAAGTTTATATCAGGCAATTGAACTTTCAAGTATTCTTTAAAGGCTTTTATAGTGAACAATGAGTTCAAAATATGGCCGTATCTTTTTTGCAGAAAATTGTTTTCATTGCACCA
ATTGACTGATTGTGATCATTAACACTGGTGTATTTTCTTACAACAACTCGTATTCATATAGGTGCGCACACAATAGGGTTTGCACAGTGCTTTACATTCAAGGATAGACTCTTCAACTTT
AATGGCTCAAATCAGCCAGACCCGGCTCTCCATACATCTCTTCTGAAAAATTTACAAAGCCAATGCCCAAATCAAGATTCCTCAAACAGTAATCTGGCTCCTCTAGACCCTGTCACAATA
AACAAGTTTGATAATGTATATTACAAGAACATTCTAAACAAGTCAGGACTTCTTCAATCAGACCAAGCTCTTATGGGAGACGCAACAAGTGCTTCCTTGGTTAATAAATACAGCAAGTAC
CCTTATCTATTTTCCAAAGATTTTGGAGCATCCATGGTGAAGATGGCCAACATTGGTGTACTTACTGGACAAACTGGAGAGATAAGGAAGAACTGCCGCGTTGCCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATCATAACCAGACTATTCAGTCAACTTTCTCCTTGGTTTGCCTTTTCTTTTTCACAAGTCCTCTCGTCTTCTGCCAACTTGATTATAGTTTTTATGATGACACTTGCCCTAATCTG
TCAAAAATTGTCACATACGCTGTGTCTTCTGCGATTGCAAATGAAACTAGGATGGCAGCCTCTCTCATCCGGTTGCACTTTCACGACTGTATCGTGAAT
GGATGTGATGGATCTGTACTA
CTTGACGATACAAGCTCTTTGAGAGGGGAGAAAGGTGCTGGAGCGAACCAAAATTCAGCTAGAGGATTCGAAATAATTGATGACATTAAGGCTAATGTGGAAGAAGCCTGCCCATCAACT
GTATCCTGCACAGATATTTTAACTCTTGCAGCAAGAGACGCGGTTTATCTT
GCTGGAGGGTCTTATTATTATGTACCCTTAGGCAGGCGAGATGCCACAACAGCAAGTTTAAGTGCAGCT
AATGAGCAGATACCAGCCCCTTTTGAGTCGTTAAGGAATATCACTGCAAAGTTTACCTCAAAGGGTCTTGATGCGAAGGATGTGGTCGTGCTCTCTG
GTGCGCACACAATAGGGTTTGCA
CAGTGCTTTACATTCAAGGATAGACTCTTCAACTTTAATGGCTCAAATCAGCCAGACCCGGCTCTCCATACATCTCTTCTGAAAAATTTACAAAGCCAATGCCCAAATCAAGATTCCTCA
AACAGTAATCTGGCTCCTCTAGACCCTGTCACAATAAACAAGTTTGATAATGTATATTACAAGAACATTCTAAACAAGTCAGGACTTCTTCAATCAGACCAAGCTCTTATGGGAGACGCA
ACAAGTGCTTCCTTGGTTAATAAATACAGCAAGTACCCTTATCTATTTTCCAAAGATTTTGGAGCATCCATGGTGAAGATGGCCAACATTGGTGTACTTACTGGACAAACTGGAGAGATA
AGGAAGAACTGCCGCGTTGCCAACTAG

Retrieve as FASTA