Entry information : AcoPrx30 (AcoGoldSmith_v1.008403m)
Entry ID 8587
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx30 (AcoGoldSmith_v1.008403m)
Name (synonym) AcoPrx30 (AcoGoldSmith_v1.008403m)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx30
start..stop
S start..stop
AfpPrx03 668 0 1..326 1..326
VvPrx02 521 0 1..325 1..325
AcoPrx28 514 0 1..325 1..326
PtPrx27 504 0 7..326 7..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 867915..868124 210 N° 2 867473..867664 192 N° 3 867089..867251 163 N° 4 866592..867007 416
complement(join(866592..867007,867089..867251,867473..867664,867915..868124))


exon

Literature and cross-references AcoPrx30 (AcoGoldSmith_v1.008403m)
DNA ref. Phytozome 12:   scaffold_47 (868124..866592)
Protein sequence: AcoPrx30 (AcoGoldSmith_v1.008403m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (303)
PWM (Da):   %s   35557.98 (33215.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.36 (7.06) Peptide Signal:   %s   cut: 24 range:24-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKTTCFGIIGLCLLASFGSAIADLELGFYDKSCPQAEKIVLEYVKKHIPNAPSLAATFIRMHFHDCFVRGCDASVLLNDTSNNQAEKDAPPNLTLRGFDFINAVKSLLEAECPGIVSCADVVSLVARDSIVTTGGPYWKVPTGRRDGTISRTSEALSNIPSPFENFTSILTKFRNKGLNVQDLVLLSGAHTIGISHCSSFTNRLYNFTGVGDQDPSLDSEYAENLKARKCKTSTDNTTIVEMDPGSFRTFDLSYYTLLLKRRGLFQSDAALTTDSTSKQFITQLVRGPLPVFLEEFTKSMEKMGAIGVKTGTNGEIRKHCALVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCAAGACAACTTGTTTTGGGATAATAGGTTTGTGTCTTCTAGCCTCGTTTGGTTCGGCTATAGCTGATTTAGAATTGGGTTTTTATGATAAAAGTTGTCCACAAGCTGAGAAAATT
GTGCTGGAGTATGTAAAGAAGCATATCCCAAATGCCCCAAGTTTGGCTGCGACATTCATTAGAATGCACTTCCATGACTGTTTTGTGAGG
GTAAGTATGCAAGGATAAAGGTTCTTCATC
CTTAGAATAAGCACTTCCATTATAGTTTATATGCAAGGATAATGGTTTTTGTTTCTTGTCAATGCTCCCATGATGTCCTTAGTTTCATTTATGATTACATATCTAGTCAGTATATGCCTA
ATAACTTCGTGTTACACTTTGTTTTCTCTGTTTCGTATTTTGCATTAATTTAATTACACTCTAAATTTTATCATTCATAACTCAAACTATCATTTCTTAGGGTTGTGATGCGTCTGTCCT
TCTGAATGACACTTCAAACAACCAAGCCGAGAAGGATGCTCCTCCCAATCTAACCCTCCGAGGGTTTGATTTCATCAATGCAGTGAAGAGTTTACTAGAAGCTGAGTGTCCTGGCATTGT
CTCGTGCGCAGATGTTGTTTCTTTAGTTGCTAGAGATTCAATTGTCACTACC
GTAAGCATTCTGTAGTAATCGACTTTATGGAACTTGGTTTGGTCATTAATTCAATTTAGTGGTGGTAC
TATTTATTTACCAATATTCTATTAGGATTATATCTTACTAAATTGGCATAAAAAAATATTCAGACATTATCAAACTACATTTTATTCCATATGCTAAGGTATTCTTTGCAAAAGGATTGA
CTGTTATTTCCAATTGTGTAATTGCAACAACAGGGAGGTCCCTATTGGAAAGTCCCAACGGGTCGTAGAGATGGGACTATTTCAAGAACATCTGAAGCATTAAGCAATATACCGTCCCCC
TTTGAAAACTTCACATCCATTTTGACAAAGTTTAGGAACAAAGGACTAAACGTGCAAGATCTTGTTCTCTTGTCAG
GTAGTTTATGCAAAATGATGTTTTACATCTAAGAAATATGTTAA
AAACTTTATATTTCTTTTTTCGATACCATATTCGCAGGTGCCCACACAATTGGGATCTCTCACTGTAGCTCCTTCACGAACCGTCTCTATAATTTCACTGGCGTGGGAGATCAAGATCCT
TCTTTAGACAGTGAATATGCTGAAAATTTGAAAGCAAGGAAATGTAAAACTTCCACTGATAACACAACTATTGTTGAGATGGATCCAGGGAGTTTCAGGACTTTCGACCTTAGCTACTAC
ACATTATTACTTAAAAGACGAGGTCTATTTCAATCGGATGCAGCTCTGACCACTGACTCCACTTCAAAACAATTTATCACCCAACTAGTCCGTGGACCACTTCCAGTTTTCCTTGAAGAG
TTCACTAAATCCATGGAGAAGATGGGTGCAATTGGTGTCAAAACTGGAACAAACGGAGAAATCAGGAAACATTGCGCATTGGTGAATAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCAAGACAACTTGTTTTGGGATAATAGGTTTGTGTCTTCTAGCCTCGTTTGGTTCGGCTATAGCTGATTTAGAATTGGGTTTTTATGATAAAAGTTGTCCACAAGCTGAGAAAATT
GTGCTGGAGTATGTAAAGAAGCATATCCCAAATGCCCCAAGTTTGGCTGCGACATTCATTAGAATGCACTTCCATGACTGTTTTGTGAGG
GGTTGTGATGCGTCTGTCCTTCTGAATGAC
ACTTCAAACAACCAAGCCGAGAAGGATGCTCCTCCCAATCTAACCCTCCGAGGGTTTGATTTCATCAATGCAGTGAAGAGTTTACTAGAAGCTGAGTGTCCTGGCATTGTCTCGTGCGCA
GATGTTGTTTCTTTAGTTGCTAGAGATTCAATTGTCACTACC
GGAGGTCCCTATTGGAAAGTCCCAACGGGTCGTAGAGATGGGACTATTTCAAGAACATCTGAAGCATTAAGCAATATA
CCGTCCCCCTTTGAAAACTTCACATCCATTTTGACAAAGTTTAGGAACAAAGGACTAAACGTGCAAGATCTTGTTCTCTTGTCAG
GTGCCCACACAATTGGGATCTCTCACTGTAGCTCC
TTCACGAACCGTCTCTATAATTTCACTGGCGTGGGAGATCAAGATCCTTCTTTAGACAGTGAATATGCTGAAAATTTGAAAGCAAGGAAATGTAAAACTTCCACTGATAACACAACTATT
GTTGAGATGGATCCAGGGAGTTTCAGGACTTTCGACCTTAGCTACTACACATTATTACTTAAAAGACGAGGTCTATTTCAATCGGATGCAGCTCTGACCACTGACTCCACTTCAAAACAA
TTTATCACCCAACTAGTCCGTGGACCACTTCCAGTTTTCCTTGAAGAGTTCACTAAATCCATGGAGAAGATGGGTGCAATTGGTGTCAAAACTGGAACAAACGGAGAAATCAGGAAACAT
TGCGCATTGGTGAATAGCTAG

Retrieve as FASTA