Entry information : Sb1CysPrx01 (Sobic.002G391100.1 [2.1] / Sb02g040650 [1.4])
Entry ID 859
Creation 2008-10-22 (Christophe Dunand)
Last sequence changes 2011-08-12 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: Sb1CysPrx01 (Sobic.002G391100.1 [2.1] / Sb02g040650 [1.4])
Name (synonym) Sb1CysPrx01 (Sobic.002G391100.1 [2.1] / Sb02g040650 [1.4])
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Callus
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Sb1CysPrx01
start..stop
S start..stop
Zm1CysPrx 421 2e-152 1..222 1..229
Hv1CysPrx 384 7e-138 1..222 1..218
Ta1CysPrx01-2D 381 5e-137 1..222 1..218
Asp1CysPrx01-B 380 1e-136 1..222 1..218
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 74565231..74565348 118 N° 2 74565437..74565987 551  
join(74565231..74565348,74565437..74565987)


exon

Literature and cross-references Sb1CysPrx01 (Sobic.002G391100.1 [2.1] / Sb02g040650 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 11:   chromosome_2 (74565231..74565987)
Cluster/Prediction ref. UniGene:   Sbi.3724
Protein sequence: Sb1CysPrx01 (Sobic.002G391100.1 [2.1] / Sb02g040650 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   222
PWM (Da):   %s   24070.19  
PI (pH):   %s   6.4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLTIGDTVPNLELDSTHGKIRIHDYVGDGYAIIFSHPADFTPVCTTEMAAMAGYAKEFEKRGVKLLGISCDDVESHREWTKDIEAYGGGKQKVTYPILADPGRDAIRQLNMVDPDEKDSNGVSLPSRALHVVGPDKAVKLSFLYPATTGRNMDEVLRAVDSLLTAAKHGGKVATPANWKPGDRAVIAPSVSDEEARKMFPHGFETADLPSKKSYLRFTKV

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 1 intron) and 18 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGGGACTCACCATCGGCGACACCGTCCCCAACCTGGAGCTGGACTCCACCCACGGCAAGATCCGCATCCACGACTACGTCGGCGACGGCTACGCCATCATCTTCTCCCACCCCGGT
ACTATACGCTCTTTTCATGCACGCACGCGCATTCTCTGTCCATCTCTGTACTGATGCATGTCATGTGACATGACACACAACATCAGCTGACTTCACGCCGGTGTGCACGACGGAGATGGC
GGCGATGGCGGGGTACGCCAAGGAGTTCGAGAAGCGTGGCGTGAAGCTGCTGGGCATCTCGTGCGACGACGTGGAGTCGCACAGGGAGTGGACCAAGGACATCGAGGCGTACGGCGGCGG
GAAGCAGAAGGTGACGTACCCGATCCTGGCGGACCCGGGTCGGGACGCCATCCGGCAGCTCAACATGGTGGACCCCGACGAGAAGGACTCCAACGGGGTGAGCCTGCCGTCCCGCGCGCT
CCACGTCGTCGGGCCCGACAAGGCCGTGAAGCTGAGCTTCCTGTACCCGGCCACCACGGGGCGGAACATGGACGAGGTGCTGCGCGCCGTCGACTCGCTGCTCACCGCCGCCAAGCACGG
CGGCAAGGTCGCCACGCCCGCCAACTGGAAGCCCGGGGACCGCGCCGTCATCGCGCCCAGCGTCTCCGACGAGGAGGCCAGGAAGATGTTCCCGCACGGGTTCGAGACCGCCGACCTGCC
CTCCAAGAAGAGCTACCTCCGCTTCACCAAGGTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGGGACTCACCATCGGCGACACCGTCCCCAACCTGGAGCTGGACTCCACCCACGGCAAGATCCGCATCCACGACTACGTCGGCGACGGCTACGCCATCATCTTCTCCCACCCCGCT
GACTTCACGCCGGTGTGCACGACGGAGATGGCGGCGATGGCGGGGTACGCCAAGGAGTTCGAGAAGCGTGGCGTGAAGCTGCTGGGCATCTCGTGCGACGACGTGGAGTCGCACAGGGAG
TGGACCAAGGACATCGAGGCGTACGGCGGCGGGAAGCAGAAGGTGACGTACCCGATCCTGGCGGACCCGGGTCGGGACGCCATCCGGCAGCTCAACATGGTGGACCCCGACGAGAAGGAC
TCCAACGGGGTGAGCCTGCCGTCCCGCGCGCTCCACGTCGTCGGGCCCGACAAGGCCGTGAAGCTGAGCTTCCTGTACCCGGCCACCACGGGGCGGAACATGGACGAGGTGCTGCGCGCC
GTCGACTCGCTGCTCACCGCCGCCAAGCACGGCGGCAAGGTCGCCACGCCCGCCAACTGGAAGCCCGGGGACCGCGCCGTCATCGCGCCCAGCGTCTCCGACGAGGAGGCCAGGAAGATG
TTCCCGCACGGGTTCGAGACCGCCGACCTGCCCTCCAAGAAGAGCTACCTCCGCTTCACCAAGGTCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CATTGCGAGA GCAGTCGTCA GCAGCTGTCT TCTTGTAACA CAACAACATC GACAAGCTGT CACAGTAGTA CGATCGACGC CACCATGCCG GGACTCACCA TCGGCGACAC CGTCCCCAAC  CTGGAGCTGG ACTCCACCCA CGGCAAGATC CGCATCCACG ACTACGTCGG CGACGGCTAC GCCATCATCT TCTCCCACCC CGCTGACTTC ACGCCGGTGT GCACGACGGA GATGGCGGCG  ATGGCGGGGT ACGCCAAGGA GTTCGAGAAG CGTGGCGTGA AGCTGCTGGG CATCTCGTGC GACGACGTGG AGTCGCACAG GGAGTGGACC AAGGACATCG AGGCGTACGG CGGCGGGAAG  CAGAAGGTGA CGTACCCGAT CCTGGCGGAC CCGGGTCGGG ACGCCATCCG GCAGCTCAAC ATGGTGGACC CCGACGAGAA GGACTCCAAC GGGGTGAGCC TGCCGTCCCG CGCGCTCCAC  GTCGTCGGGC CCGACAAGGC CGTGAAGCTG AGCTTCCTGT ACCCGGCCAC CACGGGGCGG AACATGGACG AGGTGCTGCG CGCCGTCGAC TCGCTGCTCA CCGCCGCCAA GCACGGCGGC  AAGGTCGCCA CGCCCGCCAA CTGGAAGCCC GGGGACCGCG CCGTCATCGC GCCCAGCGTC TCCGACGAGG AGGCCAGGAA GATGTTCCCG CACGGGTTCG AGACCGCCGA CCTGCCCTCC  AAGAAGAGCT ACCTCCGCTT CACCAAGGTC TAGCTAGCTA GGTGTTCGAC TGCGGACCTA GTTCGTTGCC GGCCGGCCGG CCGGCCGGCG GCGGCGTACG TGCGCGGATC TTTTGTGCCA  CCGGCCTCGG CCTGCTGGTG CTTCTAGTCT GAACTGGTAT ATGGGCTGGG CTCTATGTAT GCGGTGTATG TTCAGTAAGT ATGCTGTAAG CCTGTAACGT CACCCGTCTC GTGTACGGGT 
GGAAAACAGT GCCGCTTAGC AACGTCCATG TCCTCTTCTG AACTTGTCGC AGTGCACATC TTGTATATGT GTGAGATGTA CTACGTGTCG TCTGCCCGT 

Retrieve as FASTA