Entry information : AcoPrx35 (AcoGoldSmith_v1.008452m)
Entry ID 8592
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx35 (AcoGoldSmith_v1.008452m)
Name (synonym) AcoPrx35 (AcoGoldSmith_v1.008452m)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx35
start..stop
S start..stop
AfpPrx09 667 0 1..324 1..324
AcoPrx91 510 0 9..324 2..317
VvPrx76 499 6e-180 1..324 1..321
GmPrx328 493 6e-178 14..324 10..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1795123..1795347 225 N° 2 1794614..1794805 192 N° 3 1793948..1794113 166 N° 4 1793482..1793873 392
complement(join(1793482..1793873,1793948..1794113,1794614..1794805,1795123..1795 347))


exon

Literature and cross-references AcoPrx35 (AcoGoldSmith_v1.008452m)
DNA ref. Phytozome 12:   scaffold_5 (1795347..1793482)
Protein sequence: AcoPrx35 (AcoGoldSmith_v1.008452m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (296)
PWM (Da):   %s   34675.56 (31821.1) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.97 (10.07) Peptide Signal:   %s   cut: 29 range:29-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSCLTSIMAIVILAVLALSVGNSHAQLSTSYYSKSCPNLLKTVSAVVKSAIAKERRMGASLLRMHFHDCFVNGCDGSILLDDTSKFTGEKNAGPNRNSVRGFNVIDDIKSAVEKVCPKVVSCADILATAARDSVVILGGPTWDVKHGRRDARSASQAAANRNIPAPTFSLSNLISSFQAQGLSAKEMVALSGSHTIGLARCTTFRSRIYNDSNIDTSFAKTRQGSCPRISGSGDNNLAPLDIQTPTAFDNKYYKNLINRKGLLHSDQELFNGGSTDSQVKKYTNSPGAFSADFAAAMIKMGDIKPLTGSKGEIRKNCRRMN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCTTCTTGCTTAACTTCTATCATGGCAATAGTCATACTAGCTGTTCTTGCTCTTTCTGTAGGGAACTCACATGCTCAACTTTCGACTAGTTACTATTCAAAATCTTGTCCC
AATCTCCTTAAGACTGTTAGTGCCGTAGTGAAATCTGCAATAGCCAAAGAACGTCGTATGGGGGCATCATTGCTCCGTATGCATTTTCATGATTGCTTTGTTAAT
GTAATCTTTCTCACT
ATTTAATCTCATTGGTCTGTTGTCATGTTATATAATTGTGCTGCTTTTAACTCAAGTTGACTAATCGCTTTCTAATTACCTAATCCATACTGAAATTTTCCTCCTCTCCATAGTGATCAT
CATATTCATATCATATCTATGTACTCGATCACTTTGTTGTATAAATTAATATATAGAAGTTCATGCATGGTTAAGTAATTAAGCTGCACTGGAACACTTGTTGCTTCTGTTCATTGACAG
ATTTTACTTTAGTCTTCAGTTGCTACTCTTCACTGATATACATATCTGTTGTTACTTGTTAGGGATGTGATGGTTCGATTTTACTAGACGACACTTCAAAGTTCACAGGCGAGAAAAATG
CAGGTCCCAATCGAAATTCAGTCAGGGGATTTAATGTTATTGATGATATAAAATCTGCTGTAGAGAAGGTGTGCCCAAAGGTAGTCTCTTGTGCTGATATCCTGGCTACTGCTGCTAGAG
ACTCCGTCGTCATT
GTAAGTAGCATTTCATAATCAATTGTTTATTTGAAAAAGGACACATGACAATAGTGATTACATTTTTTTTTTTTTCTAANNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNAATGTTACAAAAAACATCACAAGTGACAAAAACACCACTTATGGAAGGGACACCCATGCTAGGAAATAACAGGTCCTACTACTCCTCTAACTA
CATCATCCCAATTCCATATCAGTTGATCGAATCTCTGCCTTCTCCTCCCAGGCCACGATGCCAGCCAATGCCAAATAATTGTTGCGTACATAATAGTAGCGATTACTTTTTCAATGGTTG
CATATATAAAGATGATTTGACCACATATAGACTAACCACAAAACTTAATATACTACTTTTAGGTGCAAGAATATGCATCCACTTAGCCAGTTAACTTTTTTTTTCACTGAGCATGATTAC
ATTGCATGTTTTTATATATGTGATATGTTTTCAGCTTGGTGGTCCAACTTGGGATGTAAAACATGGAAGAAGGGATGCTAGGAGTGCTAGTCAAGCTGCAGCTAATAGAAACATACCTGC
TCCAACTTTTAGTCTCAGTAATCTCATCTCAAGTTTCCAAGCTCAAGGTCTATCTGCCAAAGAAATGGTTGCTTTATCTG
GTAAAAAATATCTCCACTCTTCTCTAAGACAAATTTTTAC
AGAAACATTCCTTCTTATAATTCTCTTGAAACAGGTTCTCACACAATTGGACTAGCAAGGTGCACAACCTTCAGAAGTAGAATATATAATGACAGCAACATAGACACCTCCTTTGCTAAG
ACTAGGCAAGGTAGTTGCCCAAGGATTTCAGGCTCAGGGGACAACAACTTAGCACCATTAGATATTCAAACTCCAACTGCCTTTGACAATAAGTATTATAAGAACTTAATAAACCGCAAG
GGTCTTCTTCATTCTGATCAAGAATTGTTCAATGGAGGATCGACCGATTCCCAAGTTAAAAAATACACCAACAGCCCTGGAGCCTTTAGTGCAGATTTTGCCGCGGCCATGATTAAGATG
GGTGATATTAAACCACTTACTGGTTCAAAAGGAGAGATTAGAAAGAACTGCAGGAGGATGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCTTCTTGCTTAACTTCTATCATGGCAATAGTCATACTAGCTGTTCTTGCTCTTTCTGTAGGGAACTCACATGCTCAACTTTCGACTAGTTACTATTCAAAATCTTGTCCC
AATCTCCTTAAGACTGTTAGTGCCGTAGTGAAATCTGCAATAGCCAAAGAACGTCGTATGGGGGCATCATTGCTCCGTATGCATTTTCATGATTGCTTTGTTAAT
GGATGTGATGGTTCG
ATTTTACTAGACGACACTTCAAAGTTCACAGGCGAGAAAAATGCAGGTCCCAATCGAAATTCAGTCAGGGGATTTAATGTTATTGATGATATAAAATCTGCTGTAGAGAAGGTGTGCCCA
AAGGTAGTCTCTTGTGCTGATATCCTGGCTACTGCTGCTAGAGACTCCGTCGTCATT
CTTGGTGGTCCAACTTGGGATGTAAAACATGGAAGAAGGGATGCTAGGAGTGCTAGTCAAGCT
GCAGCTAATAGAAACATACCTGCTCCAACTTTTAGTCTCAGTAATCTCATCTCAAGTTTCCAAGCTCAAGGTCTATCTGCCAAAGAAATGGTTGCTTTATCTG
GTTCTCACACAATTGGA
CTAGCAAGGTGCACAACCTTCAGAAGTAGAATATATAATGACAGCAACATAGACACCTCCTTTGCTAAGACTAGGCAAGGTAGTTGCCCAAGGATTTCAGGCTCAGGGGACAACAACTTA
GCACCATTAGATATTCAAACTCCAACTGCCTTTGACAATAAGTATTATAAGAACTTAATAAACCGCAAGGGTCTTCTTCATTCTGATCAAGAATTGTTCAATGGAGGATCGACCGATTCC
CAAGTTAAAAAATACACCAACAGCCCTGGAGCCTTTAGTGCAGATTTTGCCGCGGCCATGATTAAGATGGGTGATATTAAACCACTTACTGGTTCAAAAGGAGAGATTAGAAAGAACTGC
AGGAGGATGAATTAA

Retrieve as FASTA