Entry information : AcoPrx39 (AcoGoldSmith_v1.008543m)
Entry ID 8596
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx39 (AcoGoldSmith_v1.008543m)
Name (synonym) AcoPrx39 (AcoGoldSmith_v1.008543m)
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx39
start..stop
S start..stop
CroPrx09 516 0 1..321 1..321
VvPrx68 504 0 1..321 1..322
MePrx119 493 5e-178 1..321 4..318
EcamPrx133 492 2e-177 6..321 15..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1863316..1863531 216 N° 2 1862839..1863027 189 N° 3 1862380..1862542 163 N° 4 1861610..1862007 398
complement(join(1861610..1862007,1862380..1862542,1862839..1863027,1863316..1863 531))


exon

Literature and cross-references AcoPrx39 (AcoGoldSmith_v1.008543m)
DNA ref. Phytozome 12:   scaffold_35 (1863531..1861610)
Protein sequence: AcoPrx39 (AcoGoldSmith_v1.008543m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (302)
PWM (Da):   %s   35345.49 (33076.3) Transmb domain:   %s   i2-24o
PI (pH):   %s   6.25 (6.25) Peptide Signal:   %s   cut: 20 range:20-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVFYNLVILFSLLMVITSARRFGVHGLSMIYYGMRCPLAENIVRDTVNNALQSDPTLAAGLLRMHFHDCFIEGCDGSVLLDSTKDNTAEKDSPANLSLRGYEIIDDAKQQIENQCPGVVSCADILAMAARDAVFWAGGPVYDIPTGRKDGRRSKIEDTRNLPAPFFNSSELITMFGQHGFSVQEMVVLSGAHTLGVARCSSFKNRLTKFDSTHDTDPALDSGFAAKLSKTCTAGDNAEAPFDETRNSFDNAYFNALQKKAGLLTSDQTLFASARTRNIVNSYAMNEAKFFFEFQQAMVKMGLLDVKEGKAGEVRLDCRKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTTCTATAATTTGGTTATACTATTTTCCTTATTAATGGTGATAACAAGTGCGAGAAGATTTGGTGTGCATGGTTTAAGTATGATTTACTATGGTATGCGCTGCCCATTAGCTGAA
AATATAGTGAGAGATACAGTCAACAATGCTTTGCAGTCTGATCCAACTTTGGCAGCAGGACTTCTTAGAATGCATTTCCATGATTGCTTTATAGAG
GTAACCAAATAACTTCTTAGAATG
CATTATCAATCATTTTAGAAGAGCCATTAGAATCCAAGTAACCCTATTAAGTCTGCGAACGTACTGTCTTGTTTTCTTCAATGGTAGTATTGTAGTAAGATACGATAAGATACCAGCTTT
AATCCAAATGACCCAAAGATATTGAAAGAGATCTTAATTCATTCACTCAATCGATCACCATAGATTTAGATAGGCATCTCACTGAAATTACATATATTTAGCGTGTTCGTGTTCCTTAAC
TATTTCTGTTATTTCTATATACAGGGATGTGATGGGTCAGTTCTGCTTGATTCAACAAAGGATAACACAGCAGAAAAGGACTCCCCAGCTAATTTGAGTCTGCGTGGTTACGAAATTATT
GATGATGCAAAGCAACAAATCGAGAATCAATGCCCAGGAGTAGTTTCGTGTGCCGATATTCTTGCAATGGCAGCTAGAGATGCAGTTTTCTGG
GTATGTTGTCAACATAAATATTTAAGT
TGCGTGCACTCAATCCTGTTATTATTTCTACTTACTATTACATTGTTGATTTGTTTCTAGGAATTGAAATATCAATATCACTGATATATTAGACAGAAATTTAAACAAGTTATGCTTCAC
CAACCAACTATACTTTATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATAAGTTTAGCACTGCCTTCACTCAAAATGTGTAAGCTCTGGAAATCCATAGTAATATATAATCTAAT
CTCTCAAAAATATACATATTTTATTTCAGGCTGGAGGTCCTGTATATGACATACCTACAGGAAGAAAAGATGGAAGGAGGTCTAAGATAGAAGATACAAGAAACCTGCCTGCACCATTCT
TTAACAGCTCAGAGCTTATCACAATGTTTGGGCAGCATGGTTTCAGTGTTCAAGAAATGGTGGTTTTATCTG
GTAAATATGGTTTCTTTGTTCATCTTCTCAACCATATATGTTCATAAG
AACTTCATAATTTATCTAAAAAGGCTCTGACAAGGCCGCATGTAACGATTTACTTATATGTACCTTACAAACATGAAAAGGCCGCATGTTTCTGGTATGCATAGGGCCTAATCGACTAAT
CATTAGACACAGCAATACAGGCAGCATGCTCTGAACACCTGGACATAGGCTTAAAACAGGCTTTAAATTCTGCAGGAGTACAAATTGAAGGATACAGAATTTTTTTACTAACATGTAATG
GCTGTGTTTGGTCCTATTTTTACAAGAGACCAGAATTACAATTCTGATATACAGAGATTAATTGTTTCTTGGAATGTTTGATAGGGGCACATACACTAGGAGTGGCAAGGTGTTCCTCAT
TCAAAAACAGGCTTACCAAATTCGATTCCACACACGATACTGATCCAGCTCTAGATTCAGGCTTCGCAGCCAAATTGTCTAAAACGTGCACTGCAGGAGACAATGCAGAGGCGCCATTTG
ACGAGACAAGGAACTCATTTGACAATGCATATTTCAACGCATTACAGAAGAAAGCCGGATTACTTACTTCAGATCAGACATTGTTTGCAAGCGCAAGAACCAGAAACATTGTGAATAGTT
ATGCAATGAATGAAGCTAAGTTCTTCTTTGAGTTTCAGCAAGCAATGGTGAAAATGGGATTGCTTGATGTTAAAGAAGGTAAGGCAGGAGAAGTGAGGTTAGATTGCCGTAAAATCAATT
GA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCTTCTATAATTTGGTTATACTATTTTCCTTATTAATGGTGATAACAAGTGCGAGAAGATTTGGTGTGCATGGTTTAAGTATGATTTACTATGGTATGCGCTGCCCATTAGCTGAA
AATATAGTGAGAGATACAGTCAACAATGCTTTGCAGTCTGATCCAACTTTGGCAGCAGGACTTCTTAGAATGCATTTCCATGATTGCTTTATAGAG
GGATGTGATGGGTCAGTTCTGCTT
GATTCAACAAAGGATAACACAGCAGAAAAGGACTCCCCAGCTAATTTGAGTCTGCGTGGTTACGAAATTATTGATGATGCAAAGCAACAAATCGAGAATCAATGCCCAGGAGTAGTTTCG
TGTGCCGATATTCTTGCAATGGCAGCTAGAGATGCAGTTTTCTGG
GCTGGAGGTCCTGTATATGACATACCTACAGGAAGAAAAGATGGAAGGAGGTCTAAGATAGAAGATACAAGAAAC
CTGCCTGCACCATTCTTTAACAGCTCAGAGCTTATCACAATGTTTGGGCAGCATGGTTTCAGTGTTCAAGAAATGGTGGTTTTATCTG
GGGCACATACACTAGGAGTGGCAAGGTGTTCC
TCATTCAAAAACAGGCTTACCAAATTCGATTCCACACACGATACTGATCCAGCTCTAGATTCAGGCTTCGCAGCCAAATTGTCTAAAACGTGCACTGCAGGAGACAATGCAGAGGCGCCA
TTTGACGAGACAAGGAACTCATTTGACAATGCATATTTCAACGCATTACAGAAGAAAGCCGGATTACTTACTTCAGATCAGACATTGTTTGCAAGCGCAAGAACCAGAAACATTGTGAAT
AGTTATGCAATGAATGAAGCTAAGTTCTTCTTTGAGTTTCAGCAAGCAATGGTGAAAATGGGATTGCTTGATGTTAAAGAAGGTAAGGCAGGAGAAGTGAGGTTAGATTGCCGTAAAATC
AATTGA

Retrieve as FASTA