Entry information : AcoPrx40 (AcoGoldSmith_v1.008560m)
Entry ID 8597
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx40 (AcoGoldSmith_v1.008560m)
Name (synonym) AcoPrx40 (AcoGoldSmith_v1.008560m)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx40
start..stop
S start..stop
AfpPrx27 566 0 1..320 1..285
GhPrx05 425 5e-151 3..320 9..323
CpapPrx59 413 3e-146 1..320 1..322
CclPrx116 411 2e-145 5..320 7..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2743155..2743358 204 N° 2 2743438..2743620 183 N° 3 2743711..2743873 163 N° 4 2744202..2744614 413
join(2743155..2743358,2743438..2743620,2743711..2743873,2744202..2744614)


exon

Literature and cross-references AcoPrx40 (AcoGoldSmith_v1.008560m)
DNA ref. Phytozome 12:   scaffold_22 (2743155..2744614)
Protein sequence: AcoPrx40 (AcoGoldSmith_v1.008560m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (301)
PWM (Da):   %s   35217.73 (33120.5)  
PI (pH):   %s   6.51 (6.71) Peptide Signal:   %s   cut: 20 range:20-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDLLLAFITLILILGSAQGQGNLAVGFYSRTCPNAERIVASVVQEAVRADPRKAAMLLRLHFHDCFVQGCDGSILIEGNDQTEMHADGHQGLGGFEVIEKAKAQLEATCRGVVSCADIVAMAARDSVALSNGPFYQVPTGRRDGRLSNKSFAAQMPEVNEPVQSFKAKFFQKGLSQKDLVVLSAAHTIGTTACFFMPHRLYEFPVFSSDPTINPAFLPELKKICPEHGDINTRLAMDHGSELTFDDNIFRNIRDGFAVLESDAKLYTDPITRAIIDSYLMDFVFKPSFAKDFAESMVKMGRIDVKTGSQGEIRRICKSFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCTTCTTTTAGCCTTCATCACACTTATTCTTATCCTTGGTTCTGCACAAGGACAAGGAAACCTTGCTGTTGGTTTCTACTCCAGAACATGCCCAAATGCTGAAAGAATCGTCGCT
TCTGTTGTTCAAGAAGCTGTTCGTGCTGATCCAAGAAAGGCTGCAATGTTACTTAGGCTTCATTTCCATGACTGTTTTGTTCAG
GTATCAATTCACACAATCCCTCACATTCTCCCATTC
AGAAATGATCCTTTATGTTGATTGTTGATTGTGTTGTGAACAGGGTTGTGATGGGTCAATACTTATTGAAGGTAATGACCAGACAGAAATGCATGCAGATGGTCACCAAGGTCTTGGTGG
CTTTGAAGTGATAGAGAAAGCCAAAGCTCAATTAGAAGCTACTTGTAGAGGTGTGGTTTCTTGTGCAGACATTGTGGCCATGGCAGCTAGAGATTCAGTAGCACTG
GTATTGTGATGTTT
TCTTTTGTACACAGTGCCTTCTTATATAATTATCAAGTACAGCAAGGGTTGATTGTTGTTTGGTCACTTTATGCAGAGTAATGGGCCATTTTATCAAGTTCCCACTGGCCGTAGAGATGG
TCGACTTTCGAATAAGTCTTTTGCTGCCCAGATGCCTGAGGTTAATGAGCCTGTCCAGTCATTTAAAGCCAAATTCTTCCAGAAAGGTCTTTCCCAGAAAGATCTTGTGGTTCTCAGTG
G
TACAATATCCATCTTATCTCAATGACAATTTCTTCATCTCATGGCTTGTGAAAATTTAGACCTAGCACCAACATTACAAATTTACAGTAAGATTACATTTGCATTCAATTGCTAAGTTGA
ACTTATGCTGGCAATCTATTGCATATGACATATTAAAAGATGTCAACCTGTATGTAGGACTTAGATATAAAAAGTGACAATAATGATATGATGAGGAAAGATGGAGTAGAAGAATTAATG
CAAACTGGTTTATCTACTAAAAGATTCTTAATCATGTGTTTCAGTGATCAAATACATACTAACTTGAATATCTAATGAAATATACAGCTGCACATACCATTGGAACGACTGCTTGTTTCT
TCATGCCCCATCGACTATATGAGTTTCCTGTTTTCAGTTCTGATCCAACAATCAACCCTGCTTTCCTTCCGGAGCTAAAGAAGATATGCCCAGAGCATGGAGATATCAATACTCGCTTAG
CAATGGATCATGGTAGTGAGCTTACATTTGATGACAATATCTTCCGCAACATTAGAGATGGCTTCGCAGTGTTAGAATCAGATGCTAAGCTATATACTGATCCCATAACTAGGGCTATAA
TTGACTCTTACCTCATGGACTTTGTTTTTAAACCATCTTTTGCAAAGGATTTTGCTGAGTCGATGGTGAAGATGGGAAGGATTGATGTCAAGACAGGTTCGCAAGGTGAAATAAGGCGAA
TCTGTAAGTCATTTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCTTCTTTTAGCCTTCATCACACTTATTCTTATCCTTGGTTCTGCACAAGGACAAGGAAACCTTGCTGTTGGTTTCTACTCCAGAACATGCCCAAATGCTGAAAGAATCGTCGCT
TCTGTTGTTCAAGAAGCTGTTCGTGCTGATCCAAGAAAGGCTGCAATGTTACTTAGGCTTCATTTCCATGACTGTTTTGTTCAG
GGTTGTGATGGGTCAATACTTATTGAAGGTAATGAC
CAGACAGAAATGCATGCAGATGGTCACCAAGGTCTTGGTGGCTTTGAAGTGATAGAGAAAGCCAAAGCTCAATTAGAAGCTACTTGTAGAGGTGTGGTTTCTTGTGCAGACATTGTGGCC
ATGGCAGCTAGAGATTCAGTAGCACTG
AGTAATGGGCCATTTTATCAAGTTCCCACTGGCCGTAGAGATGGTCGACTTTCGAATAAGTCTTTTGCTGCCCAGATGCCTGAGGTTAATGAG
CCTGTCCAGTCATTTAAAGCCAAATTCTTCCAGAAAGGTCTTTCCCAGAAAGATCTTGTGGTTCTCAGTG
CTGCACATACCATTGGAACGACTGCTTGTTTCTTCATGCCCCATCGACTA
TATGAGTTTCCTGTTTTCAGTTCTGATCCAACAATCAACCCTGCTTTCCTTCCGGAGCTAAAGAAGATATGCCCAGAGCATGGAGATATCAATACTCGCTTAGCAATGGATCATGGTAGT
GAGCTTACATTTGATGACAATATCTTCCGCAACATTAGAGATGGCTTCGCAGTGTTAGAATCAGATGCTAAGCTATATACTGATCCCATAACTAGGGCTATAATTGACTCTTACCTCATG
GACTTTGTTTTTAAACCATCTTTTGCAAAGGATTTTGCTGAGTCGATGGTGAAGATGGGAAGGATTGATGTCAAGACAGGTTCGCAAGGTGAAATAAGGCGAATCTGTAAGTCATTTAAC
TAA

Retrieve as FASTA