Entry information : AcoPrx42 (AcoGoldSmith_v1.008609m)
Entry ID 8598
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx42 (AcoGoldSmith_v1.008609m)
Name (synonym) AcoPrx42 (AcoGoldSmith_v1.008609m)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx42
start..stop
S start..stop
EcamPrx43 496 6e-179 3..319 5..321
EgrPrx43 496 7e-179 3..319 5..321
StPrx23 495 2e-178 2..319 9..324
LePrx32 491 5e-177 2..319 9..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2089007..2089201 195 N° 2 2088567..2088758 192 N° 3 2088274..2088436 163 N° 4 2087534..2087943 410
complement(join(2087534..2087943,2088274..2088436,2088567..2088758,2089007..2089 201))


exon

Literature and cross-references AcoPrx42 (AcoGoldSmith_v1.008609m)
DNA ref. Phytozome 12:   scaffold_37 (2089201..2087534)
Protein sequence: AcoPrx42 (AcoGoldSmith_v1.008609m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (301)
PWM (Da):   %s   34360.94 (32317.9)  
PI (pH):   %s   4.97 (4.95) Peptide Signal:   %s   cut: 19 range:19-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALVYSLLVLCSSVHLEAQLEVGFYGHTCGLAEFIVKDEVIKGLIGDRGIAAGLVRMHFHDCFVRGCDGSVLIDSISPNTAEKDSPANNPSLRGFEIIDNAKARIESICGGVVSCADILAFAARDSVQMTGGLGYDVPAGRRDGRVSLASETSNLPPPTFNVDQLTQSFKSKGLTQEEMVTLSGAHTIGRSHCTSFSNRLYNFNLTSSEDSSLDTMYLTQLQQQCPQGSNDPSDVVPMNPASPNIMDISYYRDILANRGLFTSDQTLISNLATAQQVAENSRDPFLWNSKFAAAMVKMGQIGVLTGTAGEIRLNCRVPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTGGTATATTCTCTGTTGGTTTTATGTTCAAGTGTTCACCTAGAAGCTCAGCTTGAAGTTGGTTTCTATGGACATACATGTGGTCTTGCTGAGTTTATAGTGAAAGATGAAGTG
ATAAAAGGTCTCATTGGGGATAGGGGTATTGCTGCTGGTCTTGTAAGAATGCATTTTCATGACTGTTTTGTTAGA
GTGAGTACATGCTTTCACTTTTGTTAAATTTTTGGTGATAATGGT
CTCATTGGCCACAGACAACAAAAATAATAGTTTTACTTGATGCGGCATTATATTTAAGTGTCTGATAATTTAATTCTTCGAAAAGTAACATTAAGGTAAAAATGCTGACTCGTATATACT
AGACTGTTTGCTGGCTAGCTCAATTAGTTCATGTCTTTGTGCCTATACAGTCAGATGACTAATGTGTCCCTTGTTTGTTTCAGGGATGTGATGGATCAGTGCTCATAGACTCGATTTCAC
CAAACACTGCAGAGAAGGATTCTCCAGCTAATAATCCTAGTCTTAGAGGATTTGAAATCATCGACAATGCCAAGGCTAGGATCGAATCAATATGTGGAGGAGTGGTGTCATGTGCTGATA
TTTTAGCTTTTGCAGCAAGAGATAGCGTTCAAATG
GTAAGAAGACTTCTTTCGTCCTGTATACAGGAAATGAAATTGTCTTGTGCAAATTGTTTCTGTATATGCTTGTGAGACAGTAAGT
GAAAGAACATATTAGCTGCTAATAGGTTTTAATTTCCCCGTGCAGACAGGTGGTCTTGGCTATGATGTCCCTGCTGGAAGAAGAGATGGAAGAGTTTCATTAGCATCCGAAACGTCAAAC
TTACCACCTCCAACATTTAACGTCGACCAACTAACCCAGTCCTTCAAAAGTAAGGGACTCACACAAGAAGAAATGGTTACTCTCTCTG
GTAAGAGCTTTTAACCAACAACCAAGAACCAC
TTTTGCCTAACAACCATACTAAGGATTGAGGATGATTTTGTGAATTACTGAAGTCAATTACCCTTGAAAGGATATAGGGAAATGATTGGTAGATTACTTGGCTGCAGTCAGAAAAACAAT
ATTGAAGGAAAAATCCAACATAGCTCCTGAAAGAATCTTAACAAAAAAAGCATCAGTTAATCTTAAAAGTAGTCAAGAAAATAACTACAGGAAAGGATTGTGTTTTTATCATTTGCAGTC
ATACCCTTGACCTACATGCAACATCGTCATTTATTAAGATAATGTTCCTAATGCGCAGGAGCTCATACAATTGGTCGGTCACATTGTACTTCCTTCAGTAACAGACTCTACAATTTTAAC
TTGACCTCCAGTGAAGATTCAAGTCTGGACACCATGTATCTAACCCAACTTCAGCAACAATGCCCACAAGGAAGCAATGATCCAAGTGACGTGGTTCCGATGAACCCTGCTAGTCCAAAT
ATAATGGACATCAGCTACTATAGGGACATTTTAGCCAACCGGGGACTGTTTACATCCGATCAGACCCTCATTTCCAATCTAGCTACTGCTCAGCAGGTGGCTGAGAATTCACGTGATCCA
TTTCTCTGGAATAGCAAGTTCGCAGCAGCAATGGTAAAGATGGGTCAGATAGGTGTTCTGACTGGTACTGCAGGAGAAATACGCTTAAATTGTAGGGTCCCTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTGGTATATTCTCTGTTGGTTTTATGTTCAAGTGTTCACCTAGAAGCTCAGCTTGAAGTTGGTTTCTATGGACATACATGTGGTCTTGCTGAGTTTATAGTGAAAGATGAAGTG
ATAAAAGGTCTCATTGGGGATAGGGGTATTGCTGCTGGTCTTGTAAGAATGCATTTTCATGACTGTTTTGTTAGA
GGATGTGATGGATCAGTGCTCATAGACTCGATTTCACCAAACACT
GCAGAGAAGGATTCTCCAGCTAATAATCCTAGTCTTAGAGGATTTGAAATCATCGACAATGCCAAGGCTAGGATCGAATCAATATGTGGAGGAGTGGTGTCATGTGCTGATATTTTAGCT
TTTGCAGCAAGAGATAGCGTTCAAATG
ACAGGTGGTCTTGGCTATGATGTCCCTGCTGGAAGAAGAGATGGAAGAGTTTCATTAGCATCCGAAACGTCAAACTTACCACCTCCAACATTT
AACGTCGACCAACTAACCCAGTCCTTCAAAAGTAAGGGACTCACACAAGAAGAAATGGTTACTCTCTCTG
GAGCTCATACAATTGGTCGGTCACATTGTACTTCCTTCAGTAACAGACTC
TACAATTTTAACTTGACCTCCAGTGAAGATTCAAGTCTGGACACCATGTATCTAACCCAACTTCAGCAACAATGCCCACAAGGAAGCAATGATCCAAGTGACGTGGTTCCGATGAACCCT
GCTAGTCCAAATATAATGGACATCAGCTACTATAGGGACATTTTAGCCAACCGGGGACTGTTTACATCCGATCAGACCCTCATTTCCAATCTAGCTACTGCTCAGCAGGTGGCTGAGAAT
TCACGTGATCCATTTCTCTGGAATAGCAAGTTCGCAGCAGCAATGGTAAAGATGGGTCAGATAGGTGTTCTGACTGGTACTGCAGGAGAAATACGCTTAAATTGTAGGGTCCCTAATTGA

Retrieve as FASTA