Entry information : AcoPrx52 (AcoGoldSmith_v1.013292m)
Entry ID 8602
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx52 (AcoGoldSmith_v1.013292m)
Name (synonym) AcoPrx52 (AcoGoldSmith_v1.013292m)
Class Class III peroxidase    [Orthogroup: Prx065]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx52
start..stop
S start..stop
EcamPrx74 457 2e-163 1..328 4..332
EgrPrx74 450 8e-161 23..328 12..318
EglPrx74 449 4e-160 23..328 12..318
LuPrx100 429 2e-152 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 864710..864913 204 N° 2 865465..865813 349 N° 3 865902..866344 443  
join(864710..864913,865465..865813,865902..866344)


exon

Literature and cross-references AcoPrx52 (AcoGoldSmith_v1.013292m)
DNA ref. Phytozome 12:   scaffold_47 (864710..866344)
Protein sequence: AcoPrx52 (AcoGoldSmith_v1.013292m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (309)
PWM (Da):   %s   36468.95 (34122.7)  
PI (pH):   %s   8.49 (8.64) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALLSALATLLLALQVHTAESLQFHFYQNTCPQAEVVVKRIMAEEFKKDPSIPAGLLRLHFHDCIIRGCDASVLLDSRGENIAEKEAPPNLSLRGFEVIDKIKVELERTCRGVVSCADILALATRDGVSLSGGSSYRLPTGRRDGTVSTISDVHIPGPSRPIDFVLNAVQAIGLDLDDLTTLLGAHAIGFCHCGFFIDRLYNFKGTGRADPDLDQGVFKFLTKKCPRPVNQIFNISNDPTVFMTPTTNTPFKLDSSFYHSLLNGEAALELDQGLAYTDVTQKLAMKYVKQPNVFRRKFAKAMIKLGNVGVLTGQQGEVRLNCRRVNRRNQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTCTGCTCTCTGCTCTTGCCACATTACTATTAGCTTTACAAGTACATACAGCTGAGTCCCTGCAGTTCCATTTCTATCAAAACACTTGCCCACAGGCAGAGGTTGTAGTGAAA
AGAATCATGGCAGAGGAGTTCAAAAAGGACCCTTCTATACCGGCTGGTTTACTGCGGTTGCATTTCCATGACTGTATCATTAGA
GTAAGTGTTTAAGCTTTTCCCACTTGGTTTTCTGAT
CTTGAGATTCATTTTTGAATTGGTCCATAGTATCATAGTGATATGTCAGTATGTCACATTACCAATTTTTTATCATTCACTTGAACTTATAAGTCCTTTTTGTGTGCCATTTTGATCTTA
CGTTTGTGAGTGACTGAGTGTGTGTATGTGTGTCTTATGTTTTGGAAATGTGTATCTGACATCTAGTGGTATGCAGTTATGCACGGCCGAAGCAAAAATGATTTAGGCAAAAAAGCATGA
AACTATTGACGACAAAATGATTCATACATAAGAGAATCTGTGATGCCCAATAGCCCATAAATGATATCTATTTCCATTTCTACTTGCTGTTGAACTGGAAATATGAAGAGGGTAAAACAC
ACTCAGAATTTGATAATGAATGAAACAATCCTGCATATAATAGAGAAACTTATAAACTTTTATCAAGAAATGATATCTATTTCCAATTTTCTGATCTATTGCCTAAAAACTTATATTGAT
TTGAGTCTGCCTACAACAATCTGATTTTCTTACAGGGGTGTGACGCCTCGGTTCTTCTTGATAGTAGAGGAGAAAATATTGCAGAAAAGGAAGCCCCTCCAAACTTAAGTCTTAGAGGAT
TTGAGGTGATAGATAAAATAAAAGTAGAGTTAGAGAGAACATGCAGAGGTGTTGTATCTTGCGCAGATATCTTGGCATTAGCAACCCGAGATGGAGTTTCATTATCTGGAGGATCTTCAT
ATCGATTACCTACTGGTAGACGAGATGGAACAGTTTCGACTATAAGTGATGTTCACATCCCTGGACCATCAAGACCTATAGATTTTGTACTTAATGCTGTTCAAGCTATAGGCCTTGATT
TGGATGATCTTACAACATTACTAG
GTGAGCTTAACCCTATGGATATAGAACATTAATAGATCATTCTACCATTTGGTGTATCCATTGAATTTGTTTGTCGATTGGTTTTCAGGTGCTCAT
GCAATTGGATTTTGTCATTGTGGTTTTTTCATTGATCGACTTTATAACTTCAAAGGAACAGGACGCGCAGACCCAGATTTGGATCAGGGTGTTTTCAAGTTCCTTACAAAGAAATGTCCA
AGGCCAGTTAATCAGATATTTAACATAAGCAACGATCCAACAGTATTCATGACTCCAACAACCAACACACCCTTCAAGTTAGACAGCTCGTTTTACCACAGTTTGCTCAATGGAGAAGCA
GCCCTAGAGTTAGATCAAGGGCTGGCCTATACAGATGTTACGCAAAAATTAGCAATGAAGTACGTAAAACAGCCAAATGTTTTCAGACGGAAATTTGCCAAGGCCATGATCAAATTAGGA
AATGTGGGTGTTTTAACAGGACAACAAGGAGAAGTAAGACTGAATTGTAGAAGAGTGAATAGAAGAAACCAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTCTGCTCTCTGCTCTTGCCACATTACTATTAGCTTTACAAGTACATACAGCTGAGTCCCTGCAGTTCCATTTCTATCAAAACACTTGCCCACAGGCAGAGGTTGTAGTGAAA
AGAATCATGGCAGAGGAGTTCAAAAAGGACCCTTCTATACCGGCTGGTTTACTGCGGTTGCATTTCCATGACTGTATCATTAGA
GGGTGTGACGCCTCGGTTCTTCTTGATAGTAGAGGA
GAAAATATTGCAGAAAAGGAAGCCCCTCCAAACTTAAGTCTTAGAGGATTTGAGGTGATAGATAAAATAAAAGTAGAGTTAGAGAGAACATGCAGAGGTGTTGTATCTTGCGCAGATATC
TTGGCATTAGCAACCCGAGATGGAGTTTCATTATCTGGAGGATCTTCATATCGATTACCTACTGGTAGACGAGATGGAACAGTTTCGACTATAAGTGATGTTCACATCCCTGGACCATCA
AGACCTATAGATTTTGTACTTAATGCTGTTCAAGCTATAGGCCTTGATTTGGATGATCTTACAACATTACTAG
GTGCTCATGCAATTGGATTTTGTCATTGTGGTTTTTTCATTGATCGA
CTTTATAACTTCAAAGGAACAGGACGCGCAGACCCAGATTTGGATCAGGGTGTTTTCAAGTTCCTTACAAAGAAATGTCCAAGGCCAGTTAATCAGATATTTAACATAAGCAACGATCCA
ACAGTATTCATGACTCCAACAACCAACACACCCTTCAAGTTAGACAGCTCGTTTTACCACAGTTTGCTCAATGGAGAAGCAGCCCTAGAGTTAGATCAAGGGCTGGCCTATACAGATGTT
ACGCAAAAATTAGCAATGAAGTACGTAAAACAGCCAAATGTTTTCAGACGGAAATTTGCCAAGGCCATGATCAAATTAGGAAATGTGGGTGTTTTAACAGGACAACAAGGAGAAGTAAGA
CTGAATTGTAGAAGAGTGAATAGAAGAAACCAATAA

Retrieve as FASTA