Entry information : AcoPrx56 (AcoGoldSmith_v1.013945m)
Entry ID 8606
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: AcoPrx56 (AcoGoldSmith_v1.013945m)
Name (synonym) AcoPrx56 (AcoGoldSmith_v1.013945m)
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx56
start..stop
S start..stop
AcoPrx93 528 0 16..327 1..313
AcoPrx60 522 0 7..327 3..323
AcoPrx100 501 0 1..327 1..330
VvPrx27 479 5e-172 7..327 14..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5525527..5525733 207 N° 2 5525847..5526623 777  
join(5525527..5525733,5525847..5526623)


exon

Literature and cross-references AcoPrx56 (AcoGoldSmith_v1.013945m)
DNA ref. Phytozome 12:   scaffold_3 (5525527..5526623)
Protein sequence: AcoPrx56 (AcoGoldSmith_v1.013945m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (306)
PWM (Da):   %s   35634.51 (33166.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.82 (9.76) Peptide Signal:   %s   cut: 22 range:22-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTINYLVFILAMSIMVLVSSASLKVGFYRSTCPSAESIVRKAVNKVVSRNPGIAAGLIRLQFHDCFVRGCDASVLLDSTPGNPAEKDHPAIVPSLRGFEVIDKAKAKIEAICPQTVSCADILAFAARDSAYKVGGISYVVPAGRRDGCVSPQDEVAANIPSPFFDVKQLKDNFAKKGLSLEEMVTLSGAHSIGVARCSTFSKRVYAFNSSHPQDPSLDHKYAAFLKRRCPPPLINGTIPDPTLRLDVVTPNRLDNTYYKELKNHRGLLTSDQVLLSSTSTARMVRNYILHPSTWAAKYASAMVHMGGIDVKTGTKGEIRRNCRLVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1). Incorrect prediction from phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACTATTAACTATTTAGTTTTCATTCTTGCTATGTCTATAATGGTATTGGTCTCGTCTGCATCTCTTAAAGTTGGTTTCTATCGATCAACCTGTCCGTCCGCTGAGTCCATTGTG
AGAAAAGCTGTAAACAAAGTTGTATCTCGGAATCCAGGCATAGCTGCTGGGTTGATTAGGTTGCAGTTCCATGATTGTTTTGTTAGG
GTGCGTTCATTTTTTTTTCTGTCCTTTCACTTA
CAGAATAATGAGTACTTGTGTTGCGGTGGTTAATTGCAGTACTAAATATAATGTATTGTACACATATGTTTCATGCGCAGGGATGTGATGCATCAGTGTTACTTGATTCAACACCGGGAA
ATCCTGCAGAGAAAGACCATCCTGCGATAGTTCCAAGCTTACGAGGGTTTGAAGTCATTGACAAGGCTAAGGCTAAAATTGAAGCTATATGTCCTCAGACCGTGTCGTGTGCAGATATTC
TTGCCTTTGCGGCTCGTGACAGTGCTTATAAGGTTGGAGGAATCAGCTATGTTGTCCCAGCAGGGCGACGGGATGGGTGTGTTTCTCCCCAGGATGAAGTTGCTGCTAACATCCCAAGTC
CTTTCTTTGATGTCAAGCAGCTCAAGGACAACTTTGCCAAGAAAGGTTTGTCTCTTGAGGAGATGGTGACATTATCTGGTGCCCACTCTATCGGAGTCGCCCGTTGCTCTACTTTCTCTA
AACGTGTGTATGCCTTTAACTCTAGCCATCCACAAGATCCTTCATTGGATCATAAGTATGCTGCTTTCTTGAAAAGAAGGTGCCCTCCTCCATTAATCAATGGAACTATTCCAGATCCAA
CATTGCGACTTGATGTTGTAACGCCTAATAGATTGGACAATACGTACTACAAGGAATTGAAAAACCACAGAGGCTTATTGACTTCAGATCAAGTTCTCCTTAGTAGTACTTCAACAGCAA
GGATGGTGAGGAACTATATCTTACACCCCTCAACGTGGGCTGCCAAATATGCATCTGCAATGGTACACATGGGAGGTATTGATGTAAAGACAGGCACAAAAGGGGAGATTAGAAGAAATT
GCAGGCTTGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACTATTAACTATTTAGTTTTCATTCTTGCTATGTCTATAATGGTATTGGTCTCGTCTGCATCTCTTAAAGTTGGTTTCTATCGATCAACCTGTCCGTCCGCTGAGTCCATTGTG
AGAAAAGCTGTAAACAAAGTTGTATCTCGGAATCCAGGCATAGCTGCTGGGTTGATTAGGTTGCAGTTCCATGATTGTTTTGTTAGG
GGATGTGATGCATCAGTGTTACTTGATTCAACA
CCGGGAAATCCTGCAGAGAAAGACCATCCTGCGATAGTTCCAAGCTTACGAGGGTTTGAAGTCATTGACAAGGCTAAGGCTAAAATTGAAGCTATATGTCCTCAGACCGTGTCGTGTGCA
GATATTCTTGCCTTTGCGGCTCGTGACAGTGCTTATAAGGTTGGAGGAATCAGCTATGTTGTCCCAGCAGGGCGACGGGATGGGTGTGTTTCTCCCCAGGATGAAGTTGCTGCTAACATC
CCAAGTCCTTTCTTTGATGTCAAGCAGCTCAAGGACAACTTTGCCAAGAAAGGTTTGTCTCTTGAGGAGATGGTGACATTATCTGGTGCCCACTCTATCGGAGTCGCCCGTTGCTCTACT
TTCTCTAAACGTGTGTATGCCTTTAACTCTAGCCATCCACAAGATCCTTCATTGGATCATAAGTATGCTGCTTTCTTGAAAAGAAGGTGCCCTCCTCCATTAATCAATGGAACTATTCCA
GATCCAACATTGCGACTTGATGTTGTAACGCCTAATAGATTGGACAATACGTACTACAAGGAATTGAAAAACCACAGAGGCTTATTGACTTCAGATCAAGTTCTCCTTAGTAGTACTTCA
ACAGCAAGGATGGTGAGGAACTATATCTTACACCCCTCAACGTGGGCTGCCAAATATGCATCTGCAATGGTACACATGGGAGGTATTGATGTAAAGACAGGCACAAAAGGGGAGATTAGA
AGAAATTGCAGGCTTGTCAACTAG

Retrieve as FASTA