Entry information : AcoPrx60 (AcoGoldSmith_v1.016029m)
Entry ID 8608
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: AcoPrx60 (AcoGoldSmith_v1.016029m)
Name (synonym) AcoPrx60 (AcoGoldSmith_v1.016029m)
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx60
start..stop
S start..stop
AcoPrx100 580 0 3..323 9..330
AcoPrx68 556 0 3..323 9..330
AcoPrx93 550 0 11..323 1..313
AcoPrx56 522 0 3..323 7..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5512170..5512364 195 N° 2 5512498..5513274 777  
join(5512170..5512364,5512498..5513274)


exon

Literature and cross-references AcoPrx60 (AcoGoldSmith_v1.016029m)
DNA ref. Phytozome 12:   scaffold_3 (5512170..5513274)
Protein sequence: AcoPrx60 (AcoGoldSmith_v1.016029m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (306)
PWM (Da):   %s   35143.71 (33265.7)  
PI (pH):   %s   8.56 (8.56) Peptide Signal:   %s   cut: 18 range:18-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTLVFILAVSMTALVSSASLQVGFYRYTCPSAESIVRKAVNKVVSRNPGIAAGLIRMHFHDCFVRGCDASVLLDSIPGSPSEKEHPANNPSLRGFEVIHEAKAQIEAVCPQVVSCADIIAFAARDSAYKVGRINYDVPAGRRDGRVSLEDEVGQNLPPPFFNSKQLEDNFAKKGLSLDEMVTLSGAHSIGVSHCSSFSNRLYAFNSTHPQDPSLDTRYAAFLRTRCPRPSSNGASRDPTLPLDGVTPNTLDNTYYKELRNHRGLLTSDQTLFDSSSTAGIVRNNILRPSTWAAKFASAMVHMGSIDVKTGREGEIRKSCKVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTCTAGTTTTTATTCTTGCGGTTTCTATGACCGCTTTGGTCTCATCAGCATCTCTTCAAGTTGGTTTCTATCGTTATACATGTCCATCAGCTGAGTCAATTGTGAGAAAGGCTGTA
AACAAAGTTGTATCTCGAAATCCAGGCATAGCTGCTGGTTTGATTAGAATGCATTTCCATGATTGTTTTGTTAGG
GTACGTACATACATTCATTTCTGTGCTTGAACATTTCTTTCACTG
TATATAAAGTAACGACATGGAGTTTTGACATTGAGGTTGTCCTAACTAGTACTAACTATAATGTACTTTATGTTTCTTAAATACGCAGGGATGTGATGCATCAGTATTACTTGATTCAAT
ACCAGGAAGTCCTTCAGAGAAAGAACATCCTGCCAACAATCCAAGCTTACGAGGTTTTGAAGTCATCCATGAGGCCAAGGCTCAAATTGAAGCTGTATGTCCTCAGGTTGTGTCTTGTGC
AGATATTATTGCCTTTGCAGCTCGTGACAGTGCATATAAGGTTGGAAGGATCAACTACGATGTGCCAGCAGGACGTCGTGATGGGCGTGTTTCTCTTGAAGATGAAGTTGGCCAAAACCT
CCCTCCACCTTTCTTCAATTCGAAACAGCTTGAGGATAACTTTGCAAAGAAAGGTTTGTCACTTGACGAGATGGTGACACTTTCCGGTGCACACTCCATTGGAGTCTCCCACTGCTCCTC
TTTCTCTAACCGTCTCTACGCCTTTAATTCCACGCATCCACAAGATCCTTCCTTGGATACTAGGTATGCTGCCTTCTTAAGAACTAGGTGCCCTCGACCATCCAGCAATGGAGCTAGCCG
AGATCCAACATTGCCACTTGATGGTGTAACACCTAATACATTAGACAACACATACTACAAGGAATTGAGAAATCATCGAGGTTTATTGACTTCAGATCAAACTCTCTTTGACAGTAGTTC
AACAGCAGGGATTGTGAGGAATAATATATTACGCCCCTCGACATGGGCTGCCAAGTTTGCATCGGCAATGGTACACATGGGGTCCATTGATGTTAAGACAGGCAGAGAAGGGGAGATCAG
GAAAAGCTGCAAGGTTGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTCTAGTTTTTATTCTTGCGGTTTCTATGACCGCTTTGGTCTCATCAGCATCTCTTCAAGTTGGTTTCTATCGTTATACATGTCCATCAGCTGAGTCAATTGTGAGAAAGGCTGTA
AACAAAGTTGTATCTCGAAATCCAGGCATAGCTGCTGGTTTGATTAGAATGCATTTCCATGATTGTTTTGTTAGG
GGATGTGATGCATCAGTATTACTTGATTCAATACCAGGAAGTCCT
TCAGAGAAAGAACATCCTGCCAACAATCCAAGCTTACGAGGTTTTGAAGTCATCCATGAGGCCAAGGCTCAAATTGAAGCTGTATGTCCTCAGGTTGTGTCTTGTGCAGATATTATTGCC
TTTGCAGCTCGTGACAGTGCATATAAGGTTGGAAGGATCAACTACGATGTGCCAGCAGGACGTCGTGATGGGCGTGTTTCTCTTGAAGATGAAGTTGGCCAAAACCTCCCTCCACCTTTC
TTCAATTCGAAACAGCTTGAGGATAACTTTGCAAAGAAAGGTTTGTCACTTGACGAGATGGTGACACTTTCCGGTGCACACTCCATTGGAGTCTCCCACTGCTCCTCTTTCTCTAACCGT
CTCTACGCCTTTAATTCCACGCATCCACAAGATCCTTCCTTGGATACTAGGTATGCTGCCTTCTTAAGAACTAGGTGCCCTCGACCATCCAGCAATGGAGCTAGCCGAGATCCAACATTG
CCACTTGATGGTGTAACACCTAATACATTAGACAACACATACTACAAGGAATTGAGAAATCATCGAGGTTTATTGACTTCAGATCAAACTCTCTTTGACAGTAGTTCAACAGCAGGGATT
GTGAGGAATAATATATTACGCCCCTCGACATGGGCTGCCAAGTTTGCATCGGCAATGGTACACATGGGGTCCATTGATGTTAAGACAGGCAGAGAAGGGGAGATCAGGAAAAGCTGCAAG
GTTGTCAACTAG

Retrieve as FASTA