Entry information : AcoPrx63 ( AcoGoldSmith_v1.016982m)
Entry ID 8611
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2015-10-15 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-04 (Catherine Mathe)
Peroxidase information: AcoPrx63 ( AcoGoldSmith_v1.016982m)
Name (synonym) AcoPrx63 ( AcoGoldSmith_v1.016982m)
Class Class III peroxidase    [Orthogroup: Prx098]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx63
start..stop
S start..stop
AfpPrx23 647 0 1..327 1..328
AcoPrx23 647 0 1..327 1..328
AcoPrx97 546 0 1..327 1..327
AcoPrx51 524 0 1..327 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1744972..1745199 228 N° 2 1744636..1744830 195 N° 3 1743972..1744532 561  
complement(join(1743972..1744532,1744636..1744830,1744972..1745199))


exon

Literature and cross-references AcoPrx63 ( AcoGoldSmith_v1.016982m)
DNA ref. Phytozome 12:   scaffold_2 (1745199..1743972)
Protein sequence: AcoPrx63 ( AcoGoldSmith_v1.016982m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (297)
PWM (Da):   %s   35275.71 (31973.8) Transmb domain:   %s   i12-34o
PI (pH):   %s   6.74 (6.27) Peptide Signal:   %s   cut: 30 range:30-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIPSSSKQYNIFLILLIVFTTILTPVLAQLSVGFYASTCPSVFDTVRSATRSAINREARMGASLIRLFFHDCFVNGCDGGILLVDTTEVPGEQSTLHNANSVRGFEVIDNIKTQVDRACGGSVVSCADILAIAARDSVVELGGPSYSIPVGRRDARAPSRTQAESDLPGFNEDLRLLLSKFSAKGFNP*EMVALSGAHTVGQAQCAVYRERIWNDTNIDPRYAESLRGNCPSTADPASDRVLAPLDPQSPNRFGNSYFQAVINRRTILRSDQVIFDGGSTDNIVRGYSDSPATFSTDFANAMVKMGNLSPLTGTQGEIRRDCKRPN*

Retrieve as FASTA  
Remarks Complete or pseudogene sequence from genomic (introns 1 and 2). Incorrect prediction from phytozome (5' end is missing and extra short intron due to stop in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATTCCTAGTAGCTCAAAGCAATACAATATATTTTTAATCCTCCTCATCGTCTTCACCACTATCTTAACCCCAGTCTTAGCACAACTCTCAGTTGGTTTCTATGCTAGTACATGC
CCTTCAGTATTCGACACTGTCCGTAGTGCAACACGGTCTGCCATCAATAGAGAAGCTCGTATGGGGGCATCTCTTATTCGCCTCTTCTTCCATGACTGTTTTGTAAAT
GTAAGTTTCATC
CTGTCCGCAACATTGGATTTTTCAGATGCATACCAACTATGTAACACCCTAGACATCGACTATTAGTTGTTGTTTTTTTTATTGATTTATTTAATTATGCATTAATATTTGATTGAATGT
TTCATGCAGGGATGTGATGGAGGGATTCTTTTGGTGGACACAACAGAAGTTCCCGGCGAACAGAGTACACTGCATAATGCAAACTCGGTTAGAGGGTTTGAGGTGATCGATAACATTAAG
ACACAGGTTGATAGAGCCTGTGGAGGCTCTGTAGTGTCCTGTGCTGATATTTTGGCAATTGCAGCGCGCGATTCTGTTGTGGAA
GTGAGTACTTTCAATCATTACTAACATCCATGCACG
CACATGAAATAAAAAAACAAAAGAAATAAAATGGAATCTAATTGTGTTTTCTTTGGATATGCAACAGCTTGGAGGACCGTCTTATTCAATCCCAGTAGGAAGAAGAGATGCTAGAGCCCC
AAGTAGAACTCAAGCCGAGAGTGATCTTCCTGGATTTAATGAGGACCTTAGGCTACTTCTCTCTAAATTCAGTGCTAAAGGATTTAATCCTTAAGAAATGGTTGCACTGTCTGGTGCACA
CACAGTTGGTCAAGCCCAATGTGCAGTATATAGAGAGCGAATCTGGAACGATACAAATATTGATCCTAGATATGCGGAATCATTACGGGGTAATTGCCCGAGTACTGCCGACCCTGCCAG
TGACCGCGTTTTGGCTCCTCTGGACCCTCAAAGTCCAAATCGATTTGGAAATAGTTATTTTCAAGCAGTGATCAATAGAAGGACAATTCTACGTTCTGATCAAGTAATATTTGATGGTGG
ATCAACAGATAATATTGTAAGAGGTTATAGCGACAGCCCTGCCACTTTCTCAACTGATTTCGCCAATGCTATGGTGAAGATGGGGAACTTGAGTCCCTTGACTGGTACCCAAGGTGAAAT
TCGAAGAGATTGTAAGAGGCCCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATTCCTAGTAGCTCAAAGCAATACAATATATTTTTAATCCTCCTCATCGTCTTCACCACTATCTTAACCCCAGTCTTAGCACAACTCTCAGTTGGTTTCTATGCTAGTACATGC
CCTTCAGTATTCGACACTGTCCGTAGTGCAACACGGTCTGCCATCAATAGAGAAGCTCGTATGGGGGCATCTCTTATTCGCCTCTTCTTCCATGACTGTTTTGTAAAT
GGATGTGATGGA
GGGATTCTTTTGGTGGACACAACAGAAGTTCCCGGCGAACAGAGTACACTGCATAATGCAAACTCGGTTAGAGGGTTTGAGGTGATCGATAACATTAAGACACAGGTTGATAGAGCCTGT
GGAGGCTCTGTAGTGTCCTGTGCTGATATTTTGGCAATTGCAGCGCGCGATTCTGTTGTGGAA
CTTGGAGGACCGTCTTATTCAATCCCAGTAGGAAGAAGAGATGCTAGAGCCCCAAGT
AGAACTCAAGCCGAGAGTGATCTTCCTGGATTTAATGAGGACCTTAGGCTACTTCTCTCTAAATTCAGTGCTAAAGGATTTAATCCTTAAGAAATGGTTGCACTGTCTGGTGCACACACA
GTTGGTCAAGCCCAATGTGCAGTATATAGAGAGCGAATCTGGAACGATACAAATATTGATCCTAGATATGCGGAATCATTACGGGGTAATTGCCCGAGTACTGCCGACCCTGCCAGTGAC
CGCGTTTTGGCTCCTCTGGACCCTCAAAGTCCAAATCGATTTGGAAATAGTTATTTTCAAGCAGTGATCAATAGAAGGACAATTCTACGTTCTGATCAAGTAATATTTGATGGTGGATCA
ACAGATAATATTGTAAGAGGTTATAGCGACAGCCCTGCCACTTTCTCAACTGATTTCGCCAATGCTATGGTGAAGATGGGGAACTTGAGTCCCTTGACTGGTACCCAAGGTGAAATTCGA
AGAGATTGTAAGAGGCCCAATTAA

Retrieve as FASTA