Entry information : AcoPrx65 (AcoGoldSmith_v1.018190m)
Entry ID 8613
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx65 (AcoGoldSmith_v1.018190m)
Name (synonym) AcoPrx65 (AcoGoldSmith_v1.018190m)
Class Class III peroxidase    [Orthogroup: Prx134]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx65
start..stop
S start..stop
AcoPrx72 590 0 1..315 1..319
AcoPrx94 582 0 1..303 1..305
AcoPrx106 553 0 1..315 1..319
AcoPrx[P]81 523 0 1..315 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11711..11926 216 N° 2 12047..12226 180 N° 3 12337..12888 552  
join(11711..11926,12047..12226,12337..12888)


exon

Literature and cross-references AcoPrx65 (AcoGoldSmith_v1.018190m)
DNA ref. Phytozome 12:   scaffold_296 (11711..12888)
Protein sequence: AcoPrx65 (AcoGoldSmith_v1.018190m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (288)
PWM (Da):   %s   33783.86 (30885.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.33 (9.54) Peptide Signal:   %s   cut: 28 range:28-315
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSTCSVLSISLVMVLLTTFSFPALAQLSVSFYASTSPSVFDTVRSATRSVINRDGRMGASILRLFFHDCFGCDGGILLSGGERNAPGNVDMVRGYDTIDSIKAQVDRACGRSVVSSADILAISSRDSIVQLGGPSYSVPLGRRDTRTPNIAGARSDLPAFFHDLRTIIDIFQRKGFSEREMVALSGAHSIGQARCSSFRDRIYSNTSNIDPAFAVSRKATCPRSGGDGNLAPLDPQSPGRFGNNYFQALMNRRGLLNSDQVLFNGGSTDSIVRTYANAASAFSTDFMNAMVKMGNLSPLTGKGEIRTTCQRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTAGTACTTGTTCAGTTCTCTCAATAAGTCTTGTTATGGTCCTTTTAACCACCTTTTCATTTCCAGCTTTAGCACAGCTTTCAGTTTCCTTTTATGCCAGTACATCCCCATCA
GTGTTTGACACTGTTCGATCAGCCACCCGGTCTGTCATCAATAGAGATGGTCGAATGGGTGCATCAATCTTACGTCTATTTTTCCATGATTGTTTT
GTTAGTATAAGTTCATTTTTCTGA
ATCAATATATATGCTTTATATGGCCATCTTAACTATATATAATTATGTAACTATAATATGTATGATCTGAAGATTTATGGTTTTTAATGGCTTCAGGGTTGCGATGGAGGTATTCTTTTG
TCTGGCGGTGAAAGAAATGCCCCAGGCAATGTGGATATGGTAAGAGGGTATGATACTATTGATAGCATAAAGGCACAGGTTGATAGAGCGTGTGGGCGTAGTGTAGTTTCATCTGCAGAC
ATTCTAGCCATTAGTAGCCGAGACTCCATTGTCCAA
GTAAGTAAACTAACTGGTCTGAAATGAATGAATTTAGATAATGGAAATCGGAAACATAATTGTATTCCCATATAAATTGTTAAT
AACCAACATTTCATTGTGTATATCAGCTTGGAGGACCAAGTTATTCGGTTCCATTAGGAAGGAGAGATACAAGAACACCAAACATTGCAGGGGCAAGAAGCGATCTTCCCGCCTTCTTTC
ATGATCTTCGAACAATCATAGATATATTTCAACGAAAAGGCTTTAGTGAACGAGAAATGGTAGCTTTATCCGGAGCACACTCAATAGGCCAAGCCCGATGCTCATCTTTTAGAGATCGAA
TCTATAGTAATACTAGCAACATCGATCCTGCGTTTGCAGTGTCTAGGAAGGCTACTTGTCCTCGTAGTGGTGGAGATGGCAACTTAGCTCCACTAGATCCTCAAAGCCCAGGTCGTTTTG
GTAACAATTATTTCCAGGCATTGATGAACAGAAGAGGACTTCTAAACTCTGATCAGGTGTTGTTTAATGGTGGCTCCACTGATTCTATTGTAAGGACATATGCCAATGCTGCTAGTGCCT
TCTCAACAGATTTCATGAATGCAATGGTTAAAATGGGGAACTTAAGTCCCTTAACTGGTAAAGGCGAGATACGCACAACTTGTCAAAGGGTAAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTAGTACTTGTTCAGTTCTCTCAATAAGTCTTGTTATGGTCCTTTTAACCACCTTTTCATTTCCAGCTTTAGCACAGCTTTCAGTTTCCTTTTATGCCAGTACATCCCCATCA
GTGTTTGACACTGTTCGATCAGCCACCCGGTCTGTCATCAATAGAGATGGTCGAATGGGTGCATCAATCTTACGTCTATTTTTCCATGATTGTTTT
GGTTGCGATGGAGGTATTCTTTTG
TCTGGCGGTGAAAGAAATGCCCCAGGCAATGTGGATATGGTAAGAGGGTATGATACTATTGATAGCATAAAGGCACAGGTTGATAGAGCGTGTGGGCGTAGTGTAGTTTCATCTGCAGAC
ATTCTAGCCATTAGTAGCCGAGACTCCATTGTCCAA
CTTGGAGGACCAAGTTATTCGGTTCCATTAGGAAGGAGAGATACAAGAACACCAAACATTGCAGGGGCAAGAAGCGATCTTCCC
GCCTTCTTTCATGATCTTCGAACAATCATAGATATATTTCAACGAAAAGGCTTTAGTGAACGAGAAATGGTAGCTTTATCCGGAGCACACTCAATAGGCCAAGCCCGATGCTCATCTTTT
AGAGATCGAATCTATAGTAATACTAGCAACATCGATCCTGCGTTTGCAGTGTCTAGGAAGGCTACTTGTCCTCGTAGTGGTGGAGATGGCAACTTAGCTCCACTAGATCCTCAAAGCCCA
GGTCGTTTTGGTAACAATTATTTCCAGGCATTGATGAACAGAAGAGGACTTCTAAACTCTGATCAGGTGTTGTTTAATGGTGGCTCCACTGATTCTATTGTAAGGACATATGCCAATGCT
GCTAGTGCCTTCTCAACAGATTTCATGAATGCAATGGTTAAAATGGGGAACTTAAGTCCCTTAACTGGTAAAGGCGAGATACGCACAACTTGTCAAAGGGTAAATTAG

Retrieve as FASTA