Entry information : AcoPrx67 (AcoGoldSmith_v1.018457m)
Entry ID 8615
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx67 (AcoGoldSmith_v1.018457m)
Name (synonym) AcoPrx67 (AcoGoldSmith_v1.018457m)
Class Class III peroxidase     [Orthogroup: Prx013]*
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx67
start..stop
S start..stop
NtPrx06-1B 267 2e-90 4..211 10..220
VvPrx59 266 7e-90 14..211 18..217
EglPrx126 264 5e-89 20..211 20..215
EgrPrx126 263 5e-89 20..211 20..215
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 715543..715791 249 N° 2 715284..715433 150 N° 3 715009..715146 138 N° 4 714827..714922 96
complement(join(714827..714922,715009..715146,715284..715433,715543..715791))


exon

Literature and cross-references AcoPrx67 (AcoGoldSmith_v1.018457m)
DNA ref. Phytozome 12:   scaffold_26 (715791..714827)
Omic ref. Genevestigator:   At4g21962 [Other strain]
Protein sequence: AcoPrx67 (AcoGoldSmith_v1.018457m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   211 (189)
PWM (Da):   %s   23061.11 (20770.9)  
PI (pH):   %s   9.86 (9.86) Peptide Signal:   %s   cut: 23 range:23-211
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNASIVFLVTLVVFGVGRLCNGQGLVPNFYMKSCPQAEKLVRTITWSKVAKNHALGAKLLRVHYHDCFVRVMINGTIYVLHAYQSEKDARPNLSLSGFDVIDYIKTQVEKECPGVVSCADILALAARDSVSFRLKKPLWDVLTGRRDGTVSLASDVNGNLPSPASDFTTLQQLFVKKTLNLKSILTWAGAHTIGVSHCGAFSKRLFNFTGK

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end are missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCAAGCATTGTATTCTTGGTTACTTTGGTTGTTTTTGGAGTTGGTAGGCTTTGCAATGGACAAGGACTTGTGCCGAACTTTTATATGAAGAGTTGTCCACAAGCTGAAAAGCTT
GTGAGAACCATTACTTGGAGTAAGGTTGCAAAAAACCATGCTCTTGGTGCTAAATTGTTGAGAGTGCACTACCATGACTGCTTTGTTAGGGTAATGATAAATGGAACCATCTATGTATTA
CATGCATAC
TGCTTACAGCTACCACAAAAANNNNNNNNNNNNNNNNNNNNCCGCTTATGCATCTTATTTCTCTCTTTTTGGCAGGGATGTGATGCGTCCTTACACAGTCGGCACTGTTCA
ATCTGAAAAAGATGCAAGGCCTAATCTTTCATTGTCAGGCTTTGATGTTATTGACTATATCAAGACTCAGGTAGAGAAAGAGTGCCCAGGAGTTGTATCATGTGCTGACATTCTTGCCTT
GGCAGCAAGAGATTCAGTATCTTTTCGA
GTAAGTCAGAATGGATATGTTTTGAGAGTGTTCACATCGTTTTCTACTGAGATATAGACTTGAGAGCATCATATACCTCCATTTGATTCTAT
ATCTATGACATAACTCAACAACTGCACATTGAATACATTTTGTAGCTAAAGAAACCACTATGGGATGTACTGACTGGTAGAAGAGATGGAACTGTTTCCCTTGCATCCGATGTGAATGGT
AACTTGCCTTCACCTGCCTCAGATTTCACCACTCTCCAGCAATTATTTGTCAAAAAAACCCTC
GACGTCAATGATCTCGTGGCATTATCAGGTACATGTGCATACATGCAGTACTGGCTT
TGCATTATGAACACTTGTAATATTAGCATAACCTTAAATCCATTTTGACTTGGGCAGGTGCACACACAATCGGAGTATCGCATTGTGGTGCATTCTCGAAGAGATTGTTTAATTTTACAG
GCAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCAAGCATTGTATTCTTGGTTACTTTGGTTGTTTTTGGAGTTGGTAGGCTTTGCAATGGACAAGGACTTGTGCCGAACTTTTATATGAAGAGTTGTCCACAAGCTGAAAAGCTT
GTGAGAACCATTACTTGGAGTAAGGTTGCAAAAAACCATGCTCTTGGTGCTAAATTGTTGAGAGTGCACTACCATGACTGCTTTGTTAGGGTAATGATAAATGGAACCATCTATGTATTA
CATGCATAC
CAATCTGAAAAAGATGCAAGGCCTAATCTTTCATTGTCAGGCTTTGATGTTATTGACTATATCAAGACTCAGGTAGAGAAAGAGTGCCCAGGAGTTGTATCATGTGCTGAC
ATTCTTGCCTTGGCAGCAAGAGATTCAGTATCTTTTCGA
CTAAAGAAACCACTATGGGATGTACTGACTGGTAGAAGAGATGGAACTGTTTCCCTTGCATCCGATGTGAATGGTAACTTG
CCTTCACCTGCCTCAGATTTCACCACTCTCCAGCAATTATTTGTCAAAAAAACCCTC
AACCTTAAATCCATTTTGACTTGGGCAGGTGCACACACAATCGGAGTATCGCATTGTGGTGCA
TTCTCGAAGAGATTGTTTAATTTTACAGGCAAA

Retrieve as FASTA