Entry information : AcoPrx68 (AcoGoldSmith_v1.018749m)
Entry ID 8616
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: AcoPrx68 (AcoGoldSmith_v1.018749m)
Name (synonym) AcoPrx68 (AcoGoldSmith_v1.018749m)
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx68
start..stop
S start..stop
AcoPrx100 565 0 1..330 1..330
AcoPrx60 556 0 9..330 3..323
AcoPrx92 503 0 17..330 1..314
AcoPrx93 501 0 17..330 1..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5483704..5483916 213 N° 2 5484774..5485550 777  
join(5483704..5483916,5484774..5485550)


exon

Literature and cross-references AcoPrx68 (AcoGoldSmith_v1.018749m)
DNA ref. Phytozome 12:   scaffold_3 (5483704..5485550)
Protein sequence: AcoPrx68 (AcoGoldSmith_v1.018749m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (307)
PWM (Da):   %s   35860.06 (33333.7) Transmb domain:   %s   i5-23o
PI (pH):   %s   8.15 (7.72) Peptide Signal:   %s   cut: 24 range:24-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTKFITYLVLILAISMTAMVSAESLRVGFYQSTCPLAELTVRRSVNRFVSRNPGIAAGLIRMHFHDCFVRGCDASVLLDSIPGSPSEKEHFANKPGNLRGYEVIYEAKAQIEALCSQVVSCADIIAFAARDSACQVGGINYDVPAGRRDGRVSLKDEVIQNLPPPSFNATQLEDNFAKKGLSLDEMVTLSGAHSLGISHCSSFSNRLYTFNSTHPQDPSMDTRYAVFLKTRCPRLSSKGASRDPTMPLDIGTPNTLDNTYYKELSNHRGLLTSDQTLFDSPSTAGFVKDNILHPSTWAAKFALAMVGVGSIDVKTGTEGEIRKNCKVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACTAAGTTTATCACCTACTTGGTTCTCATTCTTGCCATTTCTATGACAGCAATGGTCTCAGCAGAATCACTTCGAGTTGGTTTCTATCAATCAACATGTCCATTAGCTGAGTTA
ACTGTGAGAAGATCTGTAAACAGATTTGTATCTCGGAATCCTGGTATAGCTGCTGGGTTGATTAGGATGCATTTTCATGATTGTTTTGTTAGG
GTGCGTTCACTTCCATGCTTTCCATTT
TTTTATTTTTTTCCATATAGAATTATACTTGATAAGAGTAGTTATTCAGAGAGGGTACCCTCACACCATAAATGTTTTTGATCTTTGAAAACTTTTATTAGGGGCATATTTGGAATTAGA
AAAGTAGAGGATTAATATTAAGACTATGCGTCATACTCATTAGTTTCATTTTTCACCATTGTTTGATAATTGTGTTAAGTTTACAGAAGTGTTTTTGGATTTGGGTTTGATAATTTGTTC
ATAAAGAAGGAAGGATTAGTGAATTCTCTTCCAAAATGTCAAAAACCTTAGTTAACTAAATATTTTGTAATTTGATGTGGATAGTACTTAGTAGTGAGTTGACATGAATAGATCGAACTC
GGATTATCTAAGTTAATTATCTAAATATAAGAACCCATAATTCCTAACTAGATATTAGTTGAATTTGAAATTAATTAGCTCTTTAGAATAAAATTTTTGAATTTGATTGTTCAAATCTTC
CAATCATTTTTTTCAAAGATATTCTCACTATCTAGTTTTGTTATGCTTTAGGTTAGAAACCAAAATCAATTTTTAGTCGAAATTGATTGCTGTAAAATGGTAGTAAAATATTTAGATCAT
ATATTTATTATTCAATCTCCATGATTTTGAAGAGAAAATAGTATACAGGGGATGAAGAAGTTCTCTCCCCTCAATTAATTCTCTTTCATTTTTACTAATATGCCCTTAAAGAAAAACTTT
TCTAGTCAAAAGTATTAAATAACTTTGAGATATGGATCACACATCTAATAATAACGACCTTTCTAACTGAGGTGGTTATGTGCAGTACTAAATATATGTTTCTTACGTAGGGATGCGATG
CATCAGTGTTACTTGATTCAATCCCAGGAAGCCCTTCAGAGAAAGAACATTTTGCGAACAAACCTGGTAATTTACGAGGCTATGAAGTCATTTATGAAGCAAAGGCTCAAATTGAAGCTC
TATGTTCCCAGGTTGTGTCTTGTGCAGATATTATTGCCTTTGCGGCTCGTGACAGTGCATGTCAAGTTGGAGGGATCAACTATGATGTACCAGCTGGACGACGTGATGGGCGTGTTTCCC
TTAAAGATGAAGTTATACAAAACCTCCCACCACCTTCTTTCAATGCCACACAGCTTGAAGACAATTTTGCAAAGAAAGGTTTGTCTCTAGACGAGATGGTGACACTCTCGGGTGCACACT
CCCTTGGGATCTCCCATTGCTCTTCTTTCTCTAACCGTCTATATACCTTTAACTCCACCCATCCACAAGATCCTTCGATGGATACAAGGTATGCTGTGTTCCTAAAAACTAGGTGTCCTC
GACTATCCAGCAAAGGAGCTAGCCGAGATCCAACAATGCCACTTGATATCGGAACACCAAATACATTAGACAACACATACTACAAGGAATTGAGTAACCATCGAGGTTTATTGACTTCAG
ATCAAACTCTTTTTGACAGTCCCTCAACAGCAGGGTTTGTGAAGGATAATATATTACACCCTTCGACATGGGCTGCCAAGTTTGCATTGGCAATGGTAGGCGTGGGGTCTATTGATGTTA
AGACAGGTACTGAAGGGGAAATCAGGAAGAACTGCAAAGTTGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACTAAGTTTATCACCTACTTGGTTCTCATTCTTGCCATTTCTATGACAGCAATGGTCTCAGCAGAATCACTTCGAGTTGGTTTCTATCAATCAACATGTCCATTAGCTGAGTTA
ACTGTGAGAAGATCTGTAAACAGATTTGTATCTCGGAATCCTGGTATAGCTGCTGGGTTGATTAGGATGCATTTTCATGATTGTTTTGTTAGG
GGATGCGATGCATCAGTGTTACTTGAT
TCAATCCCAGGAAGCCCTTCAGAGAAAGAACATTTTGCGAACAAACCTGGTAATTTACGAGGCTATGAAGTCATTTATGAAGCAAAGGCTCAAATTGAAGCTCTATGTTCCCAGGTTGTG
TCTTGTGCAGATATTATTGCCTTTGCGGCTCGTGACAGTGCATGTCAAGTTGGAGGGATCAACTATGATGTACCAGCTGGACGACGTGATGGGCGTGTTTCCCTTAAAGATGAAGTTATA
CAAAACCTCCCACCACCTTCTTTCAATGCCACACAGCTTGAAGACAATTTTGCAAAGAAAGGTTTGTCTCTAGACGAGATGGTGACACTCTCGGGTGCACACTCCCTTGGGATCTCCCAT
TGCTCTTCTTTCTCTAACCGTCTATATACCTTTAACTCCACCCATCCACAAGATCCTTCGATGGATACAAGGTATGCTGTGTTCCTAAAAACTAGGTGTCCTCGACTATCCAGCAAAGGA
GCTAGCCGAGATCCAACAATGCCACTTGATATCGGAACACCAAATACATTAGACAACACATACTACAAGGAATTGAGTAACCATCGAGGTTTATTGACTTCAGATCAAACTCTTTTTGAC
AGTCCCTCAACAGCAGGGTTTGTGAAGGATAATATATTACACCCTTCGACATGGGCTGCCAAGTTTGCATTGGCAATGGTAGGCGTGGGGTCTATTGATGTTAAGACAGGTACTGAAGGG
GAAATCAGGAAGAACTGCAAAGTTGTCAAC

Retrieve as FASTA