Entry information : AcoPrx69 (AcoGoldSmith_v1.019185m)
Entry ID 8617
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: AcoPrx69 (AcoGoldSmith_v1.019185m)
Name (synonym) AcoPrx69 (AcoGoldSmith_v1.019185m)
Class Class III peroxidase     [Orthogroup: Prx081]*
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx69
start..stop
S start..stop
AcoPrx51 403 3e-142 7..319 15..326
AcoPrx101 395 3e-139 7..319 8..319
EgrPrx191 388 3e-136 1..319 1..317
EguPrx191 385 3e-135 1..319 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3493..3705 213 N° 2 3928..4125 198 N° 3 4318..4863 546  
join(3493..3705,3928..4125,4318..4863)


exon

Literature and cross-references AcoPrx69 (AcoGoldSmith_v1.019185m)
DNA ref. Phytozome 12:   scaffold_445 (3493..4863)
Protein sequence: AcoPrx69 (AcoGoldSmith_v1.019185m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (295)
PWM (Da):   %s   34849.62 (32285.2) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.2 (8.20) Peptide Signal:   %s   cut: 25 range:25-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSYSAFVLLAFSLILVLPLLSNAQLSDSFYTKTCPSVLDIVKSNVRSAINRDKRMGASLLRLFFHDCFVSGCDAGVLLDENLPTIDSEKNARPNRNSIRGFELIDKIKDAVDKACPGPSVSCSDILAITARDSVVELGGPSWSVPLGRRDARTANRNGAENLPSPFADLPELIKNFSDKGFTAKEMVVLSGAHSVGVARCVLFRDQLYNGTNIETLVATDRKSKCPSNGGDDNLSSIDHQSPNRFGNNYFQALVNRRGLFHSDQELFNGGSTDDMVRVYSKDSDKFYTDFANAMIKLGNLNPLTGNKGEIRKNCRKLN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCTTACAGTGCTTTTGTACTACTAGCTTTTTCCTTGATTCTAGTATTGCCTCTTCTTTCTAATGCACAACTCTCTGACTCTTTCTACACAAAAACCTGTCCCTCAGTTCTGGAT
ATAGTTAAGTCTAATGTTCGATCTGCCATAAATAGGGATAAACGAATGGGAGCTTCTCTTCTTCGTTTGTTCTTCCATGACTGTTTTGTTTCT
GTAAGAACATCTTTTGAATTCTGTTCT
TTTAAGACTTTTAGTTAGTTTTCTATACTTCAGTACAATACTAAAGATTCTTGTCAACCAGGAAAACTTATAAATCGCAGACGGTCTAAACGTCTAAGAGAATTTACATGCACACATACA
CCTTTACTAACGCAGCGATGATATACTGTTTGTATCTGTTCTTTGGTTGAACCTTTGGTATTTATATAATTGCAGGGCTGTGATGCTGGGGTGCTACTCGATGAAAACCTTCCAACAATT
GATAGTGAGAAGAACGCCCGACCTAATAGAAATTCCATCAGAGGTTTTGAGTTGATTGACAAGATCAAGGATGCAGTCGACAAGGCTTGTCCTGGACCTTCAGTCTCATGCTCTGACATT
CTTGCTATCACAGCTCGTGACTCTGTAGTTGAG
GTTAGCACTTCTAACTTGAAGAAGTGACACTGACACACCAATAAGAAGTGTTTTACTCCAAGCTTGAGAACATACTGCATATACTAC
TCAGTTGTATATCATATTTCATTACATTTAAAGTAATCAATTATCACCACAAACATGCATATAAAGCGCTAGGCAGTCTTATATATCTGTAACTCTGACTCCCAGCTAGGAGGTCCTTCA
TGGTCAGTACCACTAGGAAGAAGGGATGCAAGAACTGCAAACAGGAATGGTGCTGAAAATCTCCCATCTCCATTTGCGGATCTTCCAGAACTCATTAAGAATTTCAGTGATAAAGGCTTC
ACAGCTAAAGAGATGGTAGTCCTCTCAGGAGCTCATTCGGTTGGAGTAGCACGTTGTGTCCTATTTCGCGACCAATTATACAATGGAACAAATATTGAAACTTTGGTTGCTACTGATAGA
AAGTCAAAATGTCCATCAAATGGTGGAGACGACAACTTATCGTCAATTGATCACCAAAGTCCTAATAGATTTGGCAACAACTATTTCCAAGCACTTGTGAATAGAAGAGGTCTGTTTCAT
TCAGACCAAGAACTCTTCAATGGGGGCTCAACTGATGATATGGTGAGAGTATATAGCAAGGACTCAGACAAATTCTATACCGACTTTGCCAACGCCATGATTAAGTTGGGAAACTTGAAT
CCTCTCACAGGAAACAAAGGAGAGATCAGGAAAAATTGTAGAAAACTTAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCTTACAGTGCTTTTGTACTACTAGCTTTTTCCTTGATTCTAGTATTGCCTCTTCTTTCTAATGCACAACTCTCTGACTCTTTCTACACAAAAACCTGTCCCTCAGTTCTGGAT
ATAGTTAAGTCTAATGTTCGATCTGCCATAAATAGGGATAAACGAATGGGAGCTTCTCTTCTTCGTTTGTTCTTCCATGACTGTTTTGTTTCT
GGCTGTGATGCTGGGGTGCTACTCGAT
GAAAACCTTCCAACAATTGATAGTGAGAAGAACGCCCGACCTAATAGAAATTCCATCAGAGGTTTTGAGTTGATTGACAAGATCAAGGATGCAGTCGACAAGGCTTGTCCTGGACCTTCA
GTCTCATGCTCTGACATTCTTGCTATCACAGCTCGTGACTCTGTAGTTGAG
CTAGGAGGTCCTTCATGGTCAGTACCACTAGGAAGAAGGGATGCAAGAACTGCAAACAGGAATGGTGCT
GAAAATCTCCCATCTCCATTTGCGGATCTTCCAGAACTCATTAAGAATTTCAGTGATAAAGGCTTCACAGCTAAAGAGATGGTAGTCCTCTCAGGAGCTCATTCGGTTGGAGTAGCACGT
TGTGTCCTATTTCGCGACCAATTATACAATGGAACAAATATTGAAACTTTGGTTGCTACTGATAGAAAGTCAAAATGTCCATCAAATGGTGGAGACGACAACTTATCGTCAATTGATCAC
CAAAGTCCTAATAGATTTGGCAACAACTATTTCCAAGCACTTGTGAATAGAAGAGGTCTGTTTCATTCAGACCAAGAACTCTTCAATGGGGGCTCAACTGATGATATGGTGAGAGTATAT
AGCAAGGACTCAGACAAATTCTATACCGACTTTGCCAACGCCATGATTAAGTTGGGAAACTTGAATCCTCTCACAGGAAACAAAGGAGAGATCAGGAAAAATTGTAGAAAACTTAAC

Retrieve as FASTA