Entry information : AcoPrx75 ( AcoGoldSmith_v1.021494m)
Entry ID 8622
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2016-02-04 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-04 (Christophe Dunand)
Peroxidase information: AcoPrx75 ( AcoGoldSmith_v1.021494m)
Name (synonym) AcoPrx75 ( AcoGoldSmith_v1.021494m)
Class Class III peroxidase    [Orthogroup: Prx057]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx75
start..stop
S start..stop
AcoPrx32 430 1e-152 1..329 1..326
AcoPrx116 430 1e-152 1..329 1..326
AcoPrx115 429 3e-152 1..329 1..326
CmicPrx01 422 2e-149 1..329 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..216 216 N° 2 793..996 204 N° 3 1103..1268 166 N° 4 1383..1786 404
join(1..216,793..996,1103..1268,1383..1786)


exon

Literature and cross-references AcoPrx75 ( AcoGoldSmith_v1.021494m)
DNA ref. Phytozome 12:   scaffold_26 (721126..719344)
Protein sequence: AcoPrx75 ( AcoGoldSmith_v1.021494m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (306)
PWM (Da):   %s   36246.51 (33698.0) Transmb domain:   %s   i5-27o
PI (pH):   %s   8 (7.41) Peptide Signal:   %s   cut: 24 range:24-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRTSYVPLLVFLVIIRVLGLAHGAATLSMNFYQKSCPEAEAIIKKVTWAHVSSNPQLPAKFLRLQAHDCFVRGCDASVLLDSPPNAQEKDKAEKDAPPNKHLAGYDVIELAKAQLEKTCPGVVSCADIVALASRDSVSFQFHRSLWEVPTGRRDGTVSLQQEALAQLPDPSSNFTTLQKNFADKGININDLVVLSGAHTLGVGHCFLFKNRLYNFTGKGDTDPSIDPTYAELLKKKCLNQRDFKTTIDMDESPLTFDNNYYKILKQNKGMFTGDATLLTNPEASKIVDKMLDSKTFFTEFAQSMQRFGAIGVLTGDEGQIRKKCNVVNA

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGACTAGTTATGTTCCATTATTGGTTTTCCTAGTAATTATCAGAGTCCTTGGGCTTGCTCATGGAGCTGCTACTCTGAGCATGAATTTCTACCAGAAGAGCTGCCCTGAAGCGGAG
GCGATTATTAAAAAGGTTACTTGGGCCCATGTCTCTAGCAATCCACAATTGCCAGCCAAGTTCCTGAGATTGCAAGCTCATGATTGCTTTGTTAGG
GTACAAAGATATGCGCCTTAGATT
TTTTTCTTTTCTGTGCATTTTTGCATATAAATCCCATTGCATATTTCATAAGAGCTAATTAGTGATACCCCCCCGGAATTCAAGGCAACATAGCGATACCCCCCCCCCCCCCCCCCCCCA
ACTCCAAAAAGATTTGTGTCACCCCCCCAAAATTACTTTCCGGTAAAAAATAGACTTGAATTGCCATAAATACCCTTATGCCACATCAGACTTTGAATTTGACCTAAACCACTGCTGATG
TGGAATAAGGGTATTTATGGCAGTTCAAGTCTATTTTTCACCGGAAAATAATTTTGGGGGGGTGACACAAATCTTTTTGGAGTTGGGGGGGTATCGCTATGTTGCCTTGGATTCCGGGGG
GGTATCGCTAATTACCTCATTTCATAATATCGGCCCATACATTGGTTTCCATCACCTGGACCAATGCTTCTACCTAACATAGTTGTGTCTTTGCAGAGACATAGTTAATGTGCCCTTACG
ATAGAATTTGCATCCATAACCTTTTACTCTATATAAATAAGGCAACTCTAATCCAGTTCATTTCTCTGTCAGGGTTGTGATGCTTCAGTGTTATTAGATTCACCTCCAAATGCACAAGAG
AAAGATAAGGCTGAGAAGGACGCACCTCCCAACAAACATTTAGCAGGTTATGATGTTATTGAACTAGCGAAAGCTCAACTAGAAAAAACTTGCCCAGGAGTTGTTTCTTGTGCTGACATT
GTTGCTTTGGCTTCAAGGGACTCAGTTTCTTTCCAA
GTAAGAATCTAAACAAATATAACTAAAGTTTATTAAAATAGGAAATCACTAAAGCCCCTTATTTCCAAGCAAACACTATACAAT
TATGGGTATGATTGCATCGCAGTTCCACAGATCCTTGTGGGAAGTACCAACTGGAAGAAGAGATGGCACAGTTTCACTGCAACAAGAAGCCCTCGCCCAACTACCAGATCCTAGCTCCAA
CTTCACCACGCTCCAGAAAAACTTTGCAGATAAAGGAATAAATATCAATGACCTAGTGGTATTATCAG
GTATGCGGTTGAAGCTAGCATTACGGTTTTGGACTACTTGGTACAGTACTTT
TTAAGACTGATGTGTTTGAGAAGTTATATATAATATATGGCACTCTGTATTTTTGTGTGTAGGTGCACATACCCTTGGAGTTGGACATTGCTTTCTCTTCAAGAACAGACTCTACAACTT
CACAGGGAAGGGAGATACTGATCCCTCAATAGATCCAACCTACGCAGAATTATTAAAGAAAAAATGCCTGAACCAAAGAGACTTCAAAACCACAATCGATATGGACGAATCTCCTTTAAC
ATTTGATAACAACTACTATAAAATTCTGAAACAAAATAAGGGCATGTTCACAGGTGATGCCACACTTCTCACGAACCCAGAAGCAAGTAAAATCGTCGATAAGATGCTTGACTCAAAGAC
TTTCTTCACAGAGTTTGCCCAATCCATGCAGAGGTTCGGTGCAATTGGAGTACTTACTGGCGATGAAGGGCAGATTAGAAAGAAGTGCAATGTTGTAAATGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGACTAGTTATGTTCCATTATTGGTTTTCCTAGTAATTATCAGAGTCCTTGGGCTTGCTCATGGAGCTGCTACTCTGAGCATGAATTTCTACCAGAAGAGCTGCCCTGAAGCGGAG
GCGATTATTAAAAAGGTTACTTGGGCCCATGTCTCTAGCAATCCACAATTGCCAGCCAAGTTCCTGAGATTGCAAGCTCATGATTGCTTTGTTAGG
GGTTGTGATGCTTCAGTGTTATTA
GATTCACCTCCAAATGCACAAGAGAAAGATAAGGCTGAGAAGGACGCACCTCCCAACAAACATTTAGCAGGTTATGATGTTATTGAACTAGCGAAAGCTCAACTAGAAAAAACTTGCCCA
GGAGTTGTTTCTTGTGCTGACATTGTTGCTTTGGCTTCAAGGGACTCAGTTTCTTTCCAA
TTCCACAGATCCTTGTGGGAAGTACCAACTGGAAGAAGAGATGGCACAGTTTCACTGCAA
CAAGAAGCCCTCGCCCAACTACCAGATCCTAGCTCCAACTTCACCACGCTCCAGAAAAACTTTGCAGATAAAGGAATAAATATCAATGACCTAGTGGTATTATCAG
GTGCACATACCCTT
GGAGTTGGACATTGCTTTCTCTTCAAGAACAGACTCTACAACTTCACAGGGAAGGGAGATACTGATCCCTCAATAGATCCAACCTACGCAGAATTATTAAAGAAAAAATGCCTGAACCAA
AGAGACTTCAAAACCACAATCGATATGGACGAATCTCCTTTAACATTTGATAACAACTACTATAAAATTCTGAAACAAAATAAGGGCATGTTCACAGGTGATGCCACACTTCTCACGAAC
CCAGAAGCAAGTAAAATCGTCGATAAGATGCTTGACTCAAAGACTTTCTTCACAGAGTTTGCCCAATCCATGCAGAGGTTCGGTGCAATTGGAGTACTTACTGGCGATGAAGGGCAGATT
AGAAAGAAGTGCAATGTTGTAAATGCTTAA

Retrieve as FASTA