Entry information : AcoPrx77 (AcoGoldSmith_v1.021950m)
Entry ID 8624
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: AcoPrx77 (AcoGoldSmith_v1.021950m)
Name (synonym) AcoPrx77 (AcoGoldSmith_v1.021950m)
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx77
start..stop
S start..stop
AcoPrx60 515 0 10..321 3..323
AcoPrx100 499 5e-180 2..321 1..330
AcoPrx68 499 5e-180 2..321 1..330
AcoPrx92 493 9e-178 18..321 1..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5515161..5515373 213 N° 2 5515469..5515858 390 N° 3 5515887..5516246 360  
join(5515161..5515373,5515469..5515858,5515887..5516246)


exon

Literature and cross-references AcoPrx77 (AcoGoldSmith_v1.021950m)
DNA ref. Phytozome 12:   scaffold_3 (5515161..5516246)
Protein sequence: AcoPrx77 (AcoGoldSmith_v1.021950m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321
PWM (Da):   %s   34604.31 Transmb domain:   %s   i7-29o
PI (pH):   %s   8.48
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMKTTLIIYLVFILAFFMTSFVSASLNVGFYQLTCPSAESIVRKAVNKFVSHNPGIAAGLIPMHFHDCFVKGCDASVLLDSTPGNPAEKEHPANNPSLRGFEVIYEAKANIEAVCPQVVSCADIIAFAARDSAYKVGGIKYDVPAGRRDGRVSRKGDVPQNLPPPSFNSKQLGNNFAKKGLSLDEMVTFSGAHSIGVSDCSTPPTHVQDPAMDHMYAAFLKTRCPPLSSNGASQDPTLPLDAATPNRLDNTYYKELKKHRGLLTSDQTLFDSPSTTGMVKNNLLHPSSWTAKFASAMIHMGSIDVKTGTHGEIRKNCKCVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end is missing and Gaps in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAAGACTACGCTAATCATCTATTTAGTTTTTATTCTTGCCTTTTTCATGACTTCATTTGTCTCAGCATCACTTAATGTTGGCTTCTATCAATTAACCTGTCCATCAGCTGAGTCA
ATTGTGAGAAAGGCTGTAAACAAATTTGTATCTCATAATCCCGGCATTGCTGCTGGCTTGATTCCTATGCATTTCCATGATTGTTTCGTTAAG
GTGTGTTCATTTTATTTGTTTTCCAAA
TTAATTCACTATAGAGAAAGAAGGACCTTTCTCATTTAGTTGCTTATTAATGTTTAATTCATATGCAGGGATGTGATGCATCAGTGTTACTTGATTCAACACCAGGTAATCCTGCAGAGA
AAGAACATCCTGCGAATAATCCAAGCTTACGTGGCTTTGAAGTTATCTACGAGGCAAAGGCTAATATTGAAGCTGTATGTCCTCAGGTTGTGTCTTGTGCAGATATTATAGCCTTTGCGG
CTCGTGATAGTGCTTACAAAGTTGGAGGGATCAAGTATGATGTGCCAGCTGGGCGACGTGATGGGCGTGTTTCTCGTAAAGGTGATGTCCCCCAAAACCTCCCACCACCTTCTTTCAATT
CAAAGCAGCTTGGGAACAACTTTGCAAAAAAGGGTTTGTCTCTTGATGAGATGGTGACATTCTCAGGTGCACACTCCATTGGAGTCTCCGATTGTTCT
TCTTTCTCAAACCGTCTCTACA
CCTTTAACTCCACCCACCCACGTACAAGATCCTGCAATGGACCATATGTATGCTGCTTTCTTAAAAACTAGGTGTCCTCCACTATCCAGCAATGGAGCTAGCCAAGATCCAACATTGCCA
CTTGATGCTGCAACACCTAATAGATTGGATAACACATACTACAAGGAGTTGAAAAAACACCGAGGTTTATTGACTTCCGATCAAACTCTCTTTGACAGTCCTTCAACAACAGGGATGGTG
AAAAATAATTTGTTGCACCCATCATCATGGACAGCCAAGTTTGCTTCGGCAATGATACACATGGGATCCATTGATGTTAAGACAGGCACCCATGGGGAGATCAGGAAAAACTGCAAGTGT
GTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAAGACTACGCTAATCATCTATTTAGTTTTTATTCTTGCCTTTTTCATGACTTCATTTGTCTCAGCATCACTTAATGTTGGCTTCTATCAATTAACCTGTCCATCAGCTGAGTCA
ATTGTGAGAAAGGCTGTAAACAAATTTGTATCTCATAATCCCGGCATTGCTGCTGGCTTGATTCCTATGCATTTCCATGATTGTTTCGTTAAG
GGATGTGATGCATCAGTGTTACTTGAT
TCAACACCAGGTAATCCTGCAGAGAAAGAACATCCTGCGAATAATCCAAGCTTACGTGGCTTTGAAGTTATCTACGAGGCAAAGGCTAATATTGAAGCTGTATGTCCTCAGGTTGTGTCT
TGTGCAGATATTATAGCCTTTGCGGCTCGTGATAGTGCTTACAAAGTTGGAGGGATCAAGTATGATGTGCCAGCTGGGCGACGTGATGGGCGTGTTTCTCGTAAAGGTGATGTCCCCCAA
AACCTCCCACCACCTTCTTTCAATTCAAAGCAGCTTGGGAACAACTTTGCAAAAAAGGGTTTGTCTCTTGATGAGATGGTGACATTCTCAGGTGCACACTCCATTGGAGTCTCCGATTGT
TCT
ACTCCACCCACCCACGTACAAGATCCTGCAATGGACCATATGTATGCTGCTTTCTTAAAAACTAGGTGTCCTCCACTATCCAGCAATGGAGCTAGCCAAGATCCAACATTGCCACTT
GATGCTGCAACACCTAATAGATTGGATAACACATACTACAAGGAGTTGAAAAAACACCGAGGTTTATTGACTTCCGATCAAACTCTCTTTGACAGTCCTTCAACAACAGGGATGGTGAAA
AATAATTTGTTGCACCCATCATCATGGACAGCCAAGTTTGCTTCGGCAATGATACACATGGGATCCATTGATGTTAAGACAGGCACCCATGGGGAGATCAGGAAAAACTGCAAGTGTGTC
AAC

Retrieve as FASTA