Entry information : AcoPrx83 (AcoGoldSmith_v1.023391m)
Entry ID 8628
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: AcoPrx83 (AcoGoldSmith_v1.023391m)
Name (synonym) AcoPrx83 (AcoGoldSmith_v1.023391m)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx83
start..stop
S start..stop
PpePrx26 550 0 9..323 9..321
VvPrx47 549 0 19..323 20..324
RcPrx09 546 0 1..323 1..321
CclPrx45 540 0 1..323 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11788058..11788264 207 N° 2 11787718..11787897 180 N° 3 11787403..11787565 163 N° 4 11786811..11787229 419
complement(join(11786811..11787229,11787403..11787565,11787718..11787897,1178805 8..11788264))


exon

Literature and cross-references AcoPrx83 (AcoGoldSmith_v1.023391m)
DNA ref. Phytozome 12:   scaffold_1 (11788264..11786811)
Protein sequence: AcoPrx83 (AcoGoldSmith_v1.023391m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (303)
PWM (Da):   %s   34480.5 (32455.4)  
PI (pH):   %s   7.99 (8.21) Peptide Signal:   %s   cut: 21 range:21-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPMSLLSLVVLLVSVSVEGQGRLKTGFYSSTCPKAEAIVRSTVESHFNKDPTIAAGLLRLHFHDCFVQGCDGSVLITGSSAERNALPNLGLRGFEVIDDAKAQVEALCPGVVSCADILALAARDSVDLSKGPSWSAPTGRRDGRISSSSEASNLPSPADSIAVQRQKFAAKGLNDKDMVTLIGGHTIGQTDCVFFRYRLYNFTATGNADPTINPAFLAQLQSLCPPNGDGTKRVALDKDSQTNFDVSFFKNVKNGNGVLESDQRLWGDATTQPIVQNYAGTIRGLLGLRFDLEFSKAMIKMSGIEVKTGSQGEIRKMCSKF

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCTATGTCTTTGCTTTCTCTAGTAGTTTTGTTGGTAAGTGTTTCAGTTGAAGGCCAAGGACGTCTGAAAACTGGTTTTTATTCTTCTACTTGCCCAAAAGCTGAGGCCATAGTT
AGGTCTACTGTTGAATCACACTTTAACAAAGATCCTACTATTGCAGCTGGTTTGTTGAGATTACATTTCCATGACTGTTTTGTTCAG
GTATATTGTTACCATCTTCATTATGGTTTTTCC
GATGCAATCCCTATTGTTGCTGACTTGCCTCCATGTATGTTTTGCCTTTGTCCTATTAAGGGGTTGGGTTTATTTGCATGAAGATTAACATGCAGTAATGTAACCTGACATTTCTGTATG
TGGTCAGGGTTGCGATGGATCAGTTTTAATTACTGGATCATCTGCAGAGAGGAACGCATTGCCTAATCTTGGCCTGAGAGGCTTTGAAGTGATCGATGATGCAAAAGCACAAGTGGAAGC
CTTATGCCCTGGTGTAGTCTCTTGCGCGGACATATTGGCATTAGCAGCTCGGGATTCTGTTGATCTG
GTATAAATGAACTCAATTCAGGAACACAAACAAACTTGCACACATTATTGAAC
GATATGCTTTCATTTTAATTGCTTTACTCATTTATATCTCAAGGTTTTTATGTGTTAATAAAAAATTTAAATTGTTTTGTTCTGGTTGCAATATGTTAGAGCAAAGGTCCAAGTTGGTCA
GCACCAACAGGACGAAGAGATGGTAGGATTTCATCTTCATCTGAAGCCTCAAACTTGCCATCCCCAGCCGACTCCATTGCTGTTCAGAGGCAAAAGTTTGCAGCGAAAGGACTAAATGAC
AAAGACATGGTGACACTAATAG
GTACATACTCAATCCTGTCTCATAATTAACAACACTGATAGTCCCACGATAATTTCTTTTCGTTCCATCTTCTTGAAACCATTTCTTGACAGGGCACT
GAAACAAGGTGGATGATTCAAACTAAGAACTCGTAAAATGACATAACAACACTATATATATTTTTATGTTTACAGGTGGGCATACAATTGGGCAAACAGATTGCGTATTCTTCCGGTACC
GCCTGTACAATTTCACAGCAACCGGCAATGCAGACCCAACCATAAATCCAGCATTTCTTGCACAACTACAATCTCTTTGTCCTCCTAATGGTGATGGCACCAAACGCGTAGCACTCGATA
AGGACAGCCAGACCAACTTCGATGTTAGTTTCTTCAAGAACGTGAAAAATGGAAATGGTGTTCTAGAGTCAGATCAGAGACTTTGGGGAGATGCTACTACACAACCAATTGTTCAAAATT
ACGCAGGAACCATAAGAGGATTGCTAGGTTTGAGATTTGATCTCGAATTCTCTAAGGCTATGATTAAGATGAGTGGTATTGAAGTGAAGACAGGCTCGCAGGGGGAGATCAGAAAGATGT
GTTCCAAGTTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCTATGTCTTTGCTTTCTCTAGTAGTTTTGTTGGTAAGTGTTTCAGTTGAAGGCCAAGGACGTCTGAAAACTGGTTTTTATTCTTCTACTTGCCCAAAAGCTGAGGCCATAGTT
AGGTCTACTGTTGAATCACACTTTAACAAAGATCCTACTATTGCAGCTGGTTTGTTGAGATTACATTTCCATGACTGTTTTGTTCAG
GGTTGCGATGGATCAGTTTTAATTACTGGATCA
TCTGCAGAGAGGAACGCATTGCCTAATCTTGGCCTGAGAGGCTTTGAAGTGATCGATGATGCAAAAGCACAAGTGGAAGCCTTATGCCCTGGTGTAGTCTCTTGCGCGGACATATTGGCA
TTAGCAGCTCGGGATTCTGTTGATCTG
AGCAAAGGTCCAAGTTGGTCAGCACCAACAGGACGAAGAGATGGTAGGATTTCATCTTCATCTGAAGCCTCAAACTTGCCATCCCCAGCCGAC
TCCATTGCTGTTCAGAGGCAAAAGTTTGCAGCGAAAGGACTAAATGACAAAGACATGGTGACACTAATAG
GTGGGCATACAATTGGGCAAACAGATTGCGTATTCTTCCGGTACCGCCTG
TACAATTTCACAGCAACCGGCAATGCAGACCCAACCATAAATCCAGCATTTCTTGCACAACTACAATCTCTTTGTCCTCCTAATGGTGATGGCACCAAACGCGTAGCACTCGATAAGGAC
AGCCAGACCAACTTCGATGTTAGTTTCTTCAAGAACGTGAAAAATGGAAATGGTGTTCTAGAGTCAGATCAGAGACTTTGGGGAGATGCTACTACACAACCAATTGTTCAAAATTACGCA
GGAACCATAAGAGGATTGCTAGGTTTGAGATTTGATCTCGAATTCTCTAAGGCTATGATTAAGATGAGTGGTATTGAAGTGAAGACAGGCTCGCAGGGGGAGATCAGAAAGATGTGTTCC
AAGTTCAAT

Retrieve as FASTA