Entry information : AcoPrx91 (AcoGoldSmith_v1.025161m)
Entry ID 8635
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: AcoPrx91 (AcoGoldSmith_v1.025161m)
Name (synonym) AcoPrx91 (AcoGoldSmith_v1.025161m)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx91
start..stop
S start..stop
VvPrx76 515 0 2..317 6..321
AfpPrx09 510 0 2..317 9..324
AcoPrx35 510 0 2..317 9..324
PbPrx68 509 0 6..317 11..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6469623..6469826 204 N° 2 6470023..6470214 192 N° 3 6470317..6470482 166 N° 4 6470571..6470959 389
join(6469623..6469826,6470023..6470214,6470317..6470482,6470571..6470959)


exon

Literature and cross-references AcoPrx91 (AcoGoldSmith_v1.025161m)
DNA ref. Phytozome 12:   scaffold_4 (6469623..6470959)
Protein sequence: AcoPrx91 (AcoGoldSmith_v1.025161m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (296)
PWM (Da):   %s   34262.12 (32154.0)  
PI (pH):   %s   8.94 (8.94) Peptide Signal:   %s   cut: 22 range:22-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFLSVTLFSLLLLGIGSSSAQLSTNFYSSSCPHVLNTVESVVKSAIEKERRMGASLLRLHFHDCFVNGCDGSLLLDDTSSFTGEKRAPPNLNSARGFDVVDDIKSAVERVCPGVVSCADVLAIAARDSVVSLGGPSWKVKLGRRDARTASQNAATNSIPRPTFNLNNLISSFQAQGLSARDMVALSGSHTIGQARCTSFRNRIYNETNIDRNFARTKQGNCPRASGSGDNNIAPLDIQTPTSFENNYYKNLINQRGLLHSDQELFNGGSTDSLVRTYSNNPSTFNADFVSAMIKMGDIRPLTGSNGEIRRNCRRT

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTCTTTCTGTCACATTGTTTTCTCTGCTTCTTTTGGGTATTGGGAGCTCCTCAGCTCAACTCTCAACAAACTTTTACTCTAGTTCATGTCCTCATGTTCTTAACACAGTGGAA
TCTGTAGTTAAATCTGCAATAGAAAAGGAGCGTCGAATGGGTGCTTCTCTTCTCCGTTTGCACTTTCATGACTGTTTTGTTAAT
GTAAGTAACATACATATATATATTATAATACCAAAC
ATTCCACAATTTTGTTAATATCTCATTACCAGCTGGATATTAAGTTATTGAGATTATGTATGCATCTGTAGAAGTTTATATTAGCGTTTTATTTGCTGGCGTAATTGTGGAAGATATATA
TTTTCGTCTCTAAAGCAAAAACGCTATGTATTCCAAACAGGGTTGTGATGGTTCCTTACTACTTGACGATACATCATCTTTTACTGGAGAGAAAAGAGCACCTCCAAATCTGAACTCCGC
AAGAGGATTTGATGTTGTTGACGATATAAAGTCTGCGGTAGAGAGGGTGTGCCCTGGGGTGGTGTCTTGCGCTGATGTCTTAGCCATTGCAGCTCGTGACTCAGTTGTTTCT
GTATGTAT
TTGAATTATAGTAATACAACAATTTTAGTCATGACCAATATTAAAGAGTTACGTACAATTTCGTGAAATGATGTTTGTATCATGCAAATTGCAGCTTGGAGGACCTAGTTGGAAAGTTAA
GCTAGGAAGAAGAGACGCGAGAACTGCAAGCCAAAATGCTGCTACCAATAGCATCCCTCGTCCAACCTTTAACCTTAATAACCTCATTTCAAGTTTCCAAGCTCAGGGTTTGTCTGCTCG
GGACATGGTAGCCTTATCAG
GTATATGAAACATCGCTCTTTCTCTCTCGGTCTTTCAAACACACACACACCTACTGGCTACTGACAATTACTTTTTTAATTCCTACAGGTTCACATACTA
TCGGACAAGCAAGGTGTACTAGCTTCAGAAACAGAATTTACAATGAAACCAACATTGATAGAAACTTTGCAAGGACAAAACAGGGCAATTGCCCAAGGGCTTCAGGTTCTGGAGACAATA
ACATAGCACCTTTAGACATCCAGACTCCTACAAGTTTTGAAAACAACTATTACAAGAATCTCATTAACCAAAGAGGCCTACTTCACTCTGATCAAGAATTGTTCAATGGTGGATCAACTG
ATTCATTAGTGAGAACTTACAGCAACAATCCTAGCACCTTTAATGCCGATTTTGTTTCAGCTATGATAAAAATGGGAGATATTAGGCCTTTAACTGGTTCAAATGGAGAAATTAGGAGGA
ATTGCAGAAGGACTAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTCTTTCTGTCACATTGTTTTCTCTGCTTCTTTTGGGTATTGGGAGCTCCTCAGCTCAACTCTCAACAAACTTTTACTCTAGTTCATGTCCTCATGTTCTTAACACAGTGGAA
TCTGTAGTTAAATCTGCAATAGAAAAGGAGCGTCGAATGGGTGCTTCTCTTCTCCGTTTGCACTTTCATGACTGTTTTGTTAAT
GGTTGTGATGGTTCCTTACTACTTGACGATACATCA
TCTTTTACTGGAGAGAAAAGAGCACCTCCAAATCTGAACTCCGCAAGAGGATTTGATGTTGTTGACGATATAAAGTCTGCGGTAGAGAGGGTGTGCCCTGGGGTGGTGTCTTGCGCTGAT
GTCTTAGCCATTGCAGCTCGTGACTCAGTTGTTTCT
CTTGGAGGACCTAGTTGGAAAGTTAAGCTAGGAAGAAGAGACGCGAGAACTGCAAGCCAAAATGCTGCTACCAATAGCATCCCT
CGTCCAACCTTTAACCTTAATAACCTCATTTCAAGTTTCCAAGCTCAGGGTTTGTCTGCTCGGGACATGGTAGCCTTATCAG
GTTCACATACTATCGGACAAGCAAGGTGTACTAGCTTC
AGAAACAGAATTTACAATGAAACCAACATTGATAGAAACTTTGCAAGGACAAAACAGGGCAATTGCCCAAGGGCTTCAGGTTCTGGAGACAATAACATAGCACCTTTAGACATCCAGACT
CCTACAAGTTTTGAAAACAACTATTACAAGAATCTCATTAACCAAAGAGGCCTACTTCACTCTGATCAAGAATTGTTCAATGGTGGATCAACTGATTCATTAGTGAGAACTTACAGCAAC
AATCCTAGCACCTTTAATGCCGATTTTGTTTCAGCTATGATAAAAATGGGAGATATTAGGCCTTTAACTGGTTCAAATGGAGAAATTAGGAGGAATTGCAGAAGGACTAAC

Retrieve as FASTA