Entry information : AcoPrx92 (AcoGoldSmith_v1.025257m)
Entry ID 8636
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: AcoPrx92 (AcoGoldSmith_v1.025257m)
Name (synonym) AcoPrx92 (AcoGoldSmith_v1.025257m)
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx92
start..stop
S start..stop
AcoPrx60 516 0 1..314 11..323
AcoPrx93 503 0 6..314 7..313
AcoPrx68 503 0 1..314 17..330
AcoPrx100 498 1e-179 1..314 17..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5492558..5492719 162 N° 2 5492851..5493633 783  
join(5492558..5492719,5492851..5493633)


exon

Literature and cross-references AcoPrx92 (AcoGoldSmith_v1.025257m)
DNA ref. Phytozome 12:   scaffold_3 (5492558..5493633)
Protein sequence: AcoPrx92 (AcoGoldSmith_v1.025257m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315
PWM (Da):   %s   34167.39  
PI (pH):   %s   9.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSLVSASLHVGFYQKTCPLAESIVRNAVNKVVSRNPGIVAGLIRMHFHDCFVNGCDGSVLLDSTPGSPAEKEHPANNPINLHGFEVIYAAKAKIEAVCPQVVSCADIIAFAARDSAYIAGGIKYSVPSGRRDGRVSRKDDVLKNLPPPFFNAKQLENNFAKKGLSLDEMVTLSGAHSIGVSHCSSFSNRLYTFNSTHPQDPSMDRKYAAFLKTKCPAPSSNGAKQQDPTLSLDIGTPIRLDNAYYKELKKHRGLLTSDQTLFDSPLTTDMVKKNIVRPSTWANKFAAAMIHMGSIDVKTGNHGEIRKNCKVINK

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCTCATTGGTCTCAGCATCACTTCATGTTGGCTTCTATCAAAAAACCTGTCCATTAGCTGAGTCAATTGTAAGAAACGCTGTAAACAAAGTTGTATCTCGAAATCCAGGCATAGTT
GCGGGCTTGATTCGGATGCATTTCCATGATTGTTTTGTTAAT
GTGGGTTCATTTCTATACTAGCTTTCACATTTATTTTTTCTCTTCTCACTGTAGAGTATTATGGACTATTGTGTTTGA
GGTTGTTATTAGAAGTACTAAATGTAATGTATTATTGTTTGTTTCTTATGCAGGGATGTGATGGATCAGTATTACTTGATTCAACGCCAGGTAGCCCTGCAGAGAAAGAACATCCAGCGA
ACAATCCAATAAACTTACATGGCTTTGAAGTCATCTATGCCGCAAAGGCTAAAATTGAAGCTGTATGTCCTCAGGTTGTGTCTTGTGCAGATATTATTGCCTTTGCAGCTCGTGACAGTG
CTTATATAGCTGGTGGAATCAAGTATTCTGTGCCATCTGGGCGACGTGATGGGCGTGTTTCTCGTAAAGATGATGTCCTCAAAAACCTCCCACCACCTTTCTTCAATGCTAAGCAGCTTG
AGAACAACTTTGCCAAGAAAGGTTTGTCTCTGGACGAGATGGTGACACTCTCAGGGGCACACTCCATTGGGGTCTCTCATTGTTCTTCTTTCTCAAACCGTCTCTACACCTTTAACTCTA
CCCATCCACAAGATCCTTCAATGGACCGCAAGTATGCTGCTTTCTTAAAAACTAAATGTCCTGCACCATCCAGCAATGGAGCCAAGCAGCAAGATCCGACATTGTCACTTGATATTGGAA
CACCTATTAGATTGGACAACGCATACTACAAGGAATTGAAAAAACACCGAGGTTTATTGACTTCAGATCAAACTCTCTTTGACAGTCCCTTGACAACAGACATGGTGAAGAAGAATATTG
TACGCCCGTCAACATGGGCAAACAAGTTTGCTGCCGCAATGATACACATGGGGTCCATTGATGTAAAGACAGGCAACCATGGGGAGATCAGGAAGAACTGCAAGGTTATCAACAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCTCATTGGTCTCAGCATCACTTCATGTTGGCTTCTATCAAAAAACCTGTCCATTAGCTGAGTCAATTGTAAGAAACGCTGTAAACAAAGTTGTATCTCGAAATCCAGGCATAGTT
GCGGGCTTGATTCGGATGCATTTCCATGATTGTTTTGTTAAT
GGATGTGATGGATCAGTATTACTTGATTCAACGCCAGGTAGCCCTGCAGAGAAAGAACATCCAGCGAACAATCCAATA
AACTTACATGGCTTTGAAGTCATCTATGCCGCAAAGGCTAAAATTGAAGCTGTATGTCCTCAGGTTGTGTCTTGTGCAGATATTATTGCCTTTGCAGCTCGTGACAGTGCTTATATAGCT
GGTGGAATCAAGTATTCTGTGCCATCTGGGCGACGTGATGGGCGTGTTTCTCGTAAAGATGATGTCCTCAAAAACCTCCCACCACCTTTCTTCAATGCTAAGCAGCTTGAGAACAACTTT
GCCAAGAAAGGTTTGTCTCTGGACGAGATGGTGACACTCTCAGGGGCACACTCCATTGGGGTCTCTCATTGTTCTTCTTTCTCAAACCGTCTCTACACCTTTAACTCTACCCATCCACAA
GATCCTTCAATGGACCGCAAGTATGCTGCTTTCTTAAAAACTAAATGTCCTGCACCATCCAGCAATGGAGCCAAGCAGCAAGATCCGACATTGTCACTTGATATTGGAACACCTATTAGA
TTGGACAACGCATACTACAAGGAATTGAAAAAACACCGAGGTTTATTGACTTCAGATCAAACTCTCTTTGACAGTCCCTTGACAACAGACATGGTGAAGAAGAATATTGTACGCCCGTCA
ACATGGGCAAACAAGTTTGCTGCCGCAATGATACACATGGGGTCCATTGATGTAAAGACAGGCAACCATGGGGAGATCAGGAAGAACTGCAAGGTTATCAACAAA

Retrieve as FASTA