Entry information : AcoPrx93 (AcoGoldSmith_v1.025382m)
Entry ID 8637
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: AcoPrx93 (AcoGoldSmith_v1.025382m)
Name (synonym) AcoPrx93 (AcoGoldSmith_v1.025382m)
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx93
start..stop
S start..stop
AcoPrx60 550 0 1..313 11..323
AcoPrx56 528 0 1..313 16..327
AcoPrx100 523 0 1..313 17..330
AcoPrx92 503 0 7..313 6..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5522996..5523160 165 N° 2 5523297..5524070 774  
join(5522996..5523160,5523297..5524070)


exon

Literature and cross-references AcoPrx93 (AcoGoldSmith_v1.025382m)
DNA ref. Phytozome 12:   scaffold_3 (5522996..5524070)
Protein sequence: AcoPrx93 (AcoGoldSmith_v1.025382m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313
PWM (Da):   %s   33907.14  
PI (pH):   %s   9.58
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVLVSSSASLKVGFYRSTCPSAESIVRKAVNKVVSRNPGIAAGLIRMHFHDCFVRGCDASLLLDSTPGSTAEKDHPGNNPSLRGFEVIDEAKAQIEAICPQVVSCADILAFAARDSAYKVGGINYAVPSGRRDGRVSLKDEVADNIPPPFFDVKQLKDNFAKKGLSLEEMVTLSGSHSIGVARCATFSNRLYTFNSTHPQDPSMDHRYAAFLKTKCPPPSNNGARRNPTLPLDSATPNRLDNKYYKELKNHRGLLTSDQTLFNSPSTSGMVKNNILRPSTWAAKFASAMVRMGSIEVKTGTEGEIRMSCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTATTGGTGTCATCATCTGCATCTCTTAAAGTTGGTTTCTATCGATCAACATGTCCATCTGCAGAGTCAATTGTGAGAAAAGCTGTAAATAAAGTTGTATCTCGGAATCCAGGAATA
GCTGCTGGCTTGATTAGGATGCATTTCCATGATTGTTTTGTTAGG
GTGCGTTCATTATATTCCCTTGCTTTCCATTAATATATATTTTTCATTAAAGAAAATAGAATAATAAGGACCTTC
TTCCTTGCCGTGGTTTTTATTGCTATAGTACTAATAATGTATTGCATGCTACTTTTTGCAGGGATGTGATGCATCACTGTTACTTGATTCAACACCAGGAAGTACTGCAGAGAAAGACCA
TCCTGGGAACAATCCTAGCTTACGAGGCTTTGAAGTTATTGATGAGGCTAAGGCTCAAATTGAAGCTATATGTCCTCAGGTCGTGTCCTGCGCAGATATCCTTGCCTTTGCAGCTCGTGA
CAGTGCTTACAAGGTTGGAGGGATCAACTATGCTGTCCCATCAGGACGACGTGATGGGCGTGTTTCTCTTAAAGATGAAGTTGCTGATAACATCCCACCTCCTTTCTTTGATGTCAAGCA
GCTCAAGGATAACTTTGCCAAGAAGGGTTTGTCTCTTGAGGAGATGGTGACACTCTCTGGTTCACACTCTATCGGAGTCGCCCGTTGCGCTACTTTTTCTAACCGTCTCTACACCTTTAA
CTCTACCCATCCACAAGATCCTTCAATGGACCATAGGTATGCCGCTTTCTTGAAAACAAAATGCCCTCCTCCATCAAACAATGGAGCTCGTCGTAATCCAACATTGCCACTCGATTCTGC
AACACCTAATAGATTGGACAACAAATACTACAAGGAATTGAAAAACCACCGAGGTTTACTGACTTCAGATCAAACTCTCTTTAACAGTCCCTCAACATCAGGGATGGTGAAAAATAATAT
ATTACGCCCCTCGACATGGGCTGCCAAGTTTGCATCAGCAATGGTTCGGATGGGGTCCATTGAAGTGAAGACAGGAACAGAAGGGGAGATCAGGATGAGTTGCAGAGTTGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTATTGGTGTCATCATCTGCATCTCTTAAAGTTGGTTTCTATCGATCAACATGTCCATCTGCAGAGTCAATTGTGAGAAAAGCTGTAAATAAAGTTGTATCTCGGAATCCAGGAATA
GCTGCTGGCTTGATTAGGATGCATTTCCATGATTGTTTTGTTAGG
GGATGTGATGCATCACTGTTACTTGATTCAACACCAGGAAGTACTGCAGAGAAAGACCATCCTGGGAACAATCCT
AGCTTACGAGGCTTTGAAGTTATTGATGAGGCTAAGGCTCAAATTGAAGCTATATGTCCTCAGGTCGTGTCCTGCGCAGATATCCTTGCCTTTGCAGCTCGTGACAGTGCTTACAAGGTT
GGAGGGATCAACTATGCTGTCCCATCAGGACGACGTGATGGGCGTGTTTCTCTTAAAGATGAAGTTGCTGATAACATCCCACCTCCTTTCTTTGATGTCAAGCAGCTCAAGGATAACTTT
GCCAAGAAGGGTTTGTCTCTTGAGGAGATGGTGACACTCTCTGGTTCACACTCTATCGGAGTCGCCCGTTGCGCTACTTTTTCTAACCGTCTCTACACCTTTAACTCTACCCATCCACAA
GATCCTTCAATGGACCATAGGTATGCCGCTTTCTTGAAAACAAAATGCCCTCCTCCATCAAACAATGGAGCTCGTCGTAATCCAACATTGCCACTCGATTCTGCAACACCTAATAGATTG
GACAACAAATACTACAAGGAATTGAAAAACCACCGAGGTTTACTGACTTCAGATCAAACTCTCTTTAACAGTCCCTCAACATCAGGGATGGTGAAAAATAATATATTACGCCCCTCGACA
TGGGCTGCCAAGTTTGCATCAGCAATGGTTCGGATGGGGTCCATTGAAGTGAAGACAGGAACAGAAGGGGAGATCAGGATGAGTTGCAGAGTTGTCAAC

Retrieve as FASTA