Entry information : AcoPrx94 (AcoGoldSmith_v1.025566m)
Entry ID 8638
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx94 (AcoGoldSmith_v1.025566m)
Name (synonym) AcoPrx94 (AcoGoldSmith_v1.025566m)
Class Class III peroxidase     [Orthogroup: Prx104]*
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx94
start..stop
S start..stop
AcoPrx72 586 0 1..307 1..308
AcoPrx65 582 0 1..305 1..303
AcoPrx106 556 0 1..307 1..308
AcoPrx[P]81 508 0 1..307 1..306
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16526..16747 222 N° 2 16863..17042 180 N° 3 17192..17710 519  
join(16526..16747,16863..17042,17192..17710)


exon

Literature and cross-references AcoPrx94 (AcoGoldSmith_v1.025566m)
DNA ref. Phytozome 12:   scaffold_296 (16526..17710)
Protein sequence: AcoPrx94 (AcoGoldSmith_v1.025566m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   307 (280)
PWM (Da):   %s   32638.18 (29826.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.58 (8.68) Peptide Signal:   %s   cut: 28 range:28-307
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATNTCSVLSISLVMVLLTTFSFPALAQLSVSFYASTCPSVFDTVRSATRSVINRDGRMGASILRLFFHDCFVSGCDGGILLSGGERTAPGNVDMVRGYDTIDSIKAQVDRACGRSVVSCADILAISSRDSIVQLGGPSYAVPLGRRDTRTPNIAGARSDLPAFFHDLPRIINIFQGKGFSEREMVALSGAHSIGQARCSSFRDRIYSNTSNIDPAFAVSRQATCPRSGGDGNLAPLDPQSPGRFGNNYFQALMNRRGLLNSDQVLFNGGSTDSIVRTYANAANAFSTDFMNAMVKMGNLSPLTGTQ

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Short 3' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTAATACTTGTTCAGTTCTCTCAATAAGTCTTGTTATGGTTCTGTTAACAACCTTTTCATTTCCAGCTTTAGCACAACTCTCAGTTTCCTTTTATGCCAGTACATGCCCATCA
GTGTTTGATACTGTTCGATCAGCCACACGGTCTGTCATCAATAGAGATGGTCGAATGGGTGCATCAATTTTACGTCTATTTTTCCATGATTGTTTTGTTAGT
GTAAGTTCATTTTCCTGA
CTGAATATGCTTTATATCGTCATCTTAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCATGATCTGAAAATGCATGGTTTTTAATGGCTTCAGGGTTGCGATGGAGGTATTCTTTT
GTCCGGCGGTGAAAGAACTGCCCCAGGGAATGTAGATATGGTAAGAGGGTACGATACTATTGATAGCATAAAGGCACAAGTTGATAGAGCGTGTGGGCGCAGTGTAGTTTCATGTGCAGA
CATTCTAGCCATTAGTAGCCGAGACTCCATTGTCCAA
GTAAGTAAACTAATTACTGGTGTATATTAAATGAACTTAGATAAATGGAATTTGGAAACATAATATATTCCTATATTGTATAT
GCTCCTATCTATATTGTTAATAATATAATATAATAACCAACATTTCATTCTTTGTTTTTATCTCAGCTTGGAGGACCGAGTTATGCAGTTCCATTAGGAAGGAGAGATACAAGAACACCA
AACATTGCAGGAGCAAGAAGCGATCTCCCCGCCTTCTTTCACGATCTTCCAAGGATCATAAACATATTTCAAGGCAAAGGCTTTAGTGAACGAGAAATGGTAGCTTTATCTGGAGCACAC
TCAATAGGCCAAGCTCGATGCTCTTCTTTTAGAGATCGAATCTATAGTAATACTAGCAACATTGATCCCGCATTCGCAGTGTCTAGGCAGGCTACTTGTCCTCGTAGTGGTGGAGATGGA
AACTTAGCACCACTAGACCCTCAAAGCCCAGGTCGTTTTGGAAACAATTATTTCCAGGCATTGATGAACAGAAGAGGACTTCTTAACTCAGATCAGGTGTTGTTTAACGGTGGCTCGACC
GATTCTATTGTAAGGACATATGCCAATGCTGCTAATGCCTTTTCAACAGATTTCATGAATGCAATGGTTAAAATGGGGAACTTAAGTCCCTTAACTGGTACTCAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTAATACTTGTTCAGTTCTCTCAATAAGTCTTGTTATGGTTCTGTTAACAACCTTTTCATTTCCAGCTTTAGCACAACTCTCAGTTTCCTTTTATGCCAGTACATGCCCATCA
GTGTTTGATACTGTTCGATCAGCCACACGGTCTGTCATCAATAGAGATGGTCGAATGGGTGCATCAATTTTACGTCTATTTTTCCATGATTGTTTTGTTAGT
GGTTGCGATGGAGGTATT
CTTTTGTCCGGCGGTGAAAGAACTGCCCCAGGGAATGTAGATATGGTAAGAGGGTACGATACTATTGATAGCATAAAGGCACAAGTTGATAGAGCGTGTGGGCGCAGTGTAGTTTCATGT
GCAGACATTCTAGCCATTAGTAGCCGAGACTCCATTGTCCAA
CTTGGAGGACCGAGTTATGCAGTTCCATTAGGAAGGAGAGATACAAGAACACCAAACATTGCAGGAGCAAGAAGCGAT
CTCCCCGCCTTCTTTCACGATCTTCCAAGGATCATAAACATATTTCAAGGCAAAGGCTTTAGTGAACGAGAAATGGTAGCTTTATCTGGAGCACACTCAATAGGCCAAGCTCGATGCTCT
TCTTTTAGAGATCGAATCTATAGTAATACTAGCAACATTGATCCCGCATTCGCAGTGTCTAGGCAGGCTACTTGTCCTCGTAGTGGTGGAGATGGAAACTTAGCACCACTAGACCCTCAA
AGCCCAGGTCGTTTTGGAAACAATTATTTCCAGGCATTGATGAACAGAAGAGGACTTCTTAACTCAGATCAGGTGTTGTTTAACGGTGGCTCGACCGATTCTATTGTAAGGACATATGCC
AATGCTGCTAATGCCTTTTCAACAGATTTCATGAATGCAATGGTTAAAATGGGGAACTTAAGTCCCTTAACTGGTACTCAA

Retrieve as FASTA