Entry information : AcoPrx[P]71 (AcoGoldSmith_v1.019854m)
Entry ID 8644
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-07-03 (Qiang Li)
Peroxidase information: AcoPrx[P]71 (AcoGoldSmith_v1.019854m)
Name (synonym) AcoPrx[P]71 (AcoGoldSmith_v1.019854m)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx[P]71
start..stop
S start..stop
AcoPrx[P]108 326 3e-116 1..183 1..183
AcoPrx76 237 2e-79 1..183 1..193
AcoPrx16 174 2e-54 22..183 41..211
AfpPrx05 174 2e-54 22..183 41..211
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 536134..536323 190 N° 2 535516..535689 174 N° 3 534416..534586 171  
complement(join(534416..534586,535516..535689,536134..536323))


exon

Literature and cross-references AcoPrx[P]71 (AcoGoldSmith_v1.019854m)
DNA ref. Phytozome 12:   scaffold_49 (536323..534416)
Protein sequence: AcoPrx[P]71 (AcoGoldSmith_v1.019854m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   182 (159)
PWM (Da):   %s   19339.3 (16684.0)  
PI (pH):   %s   4.23 (4.15) Peptide Signal:   %s   cut: 24 range:24-182
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MS*PIFFFCCLMLLLLRQPNSTLSAEFYNTSCPEAETICMSFxxxxxNQDPTLAASLLQLSFPDCFVQGCDAFVLLDDTEYHVREKSALPNFQSLRGFDVIDTIKVELEKASPHTVSCSDVLYYHINGALSSAGERESFVANNTAVFQGLPNPNSELADLFAKFEQAGMNLKDMVGLSGGHTI

Retrieve as FASTA  
Remarks Stop in frame. 3' end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTTTTCTTCTGTTGCTTAATGCTACTGCTTCTTCGTCAGCCTAATTCCACTTTAAGTGCAGAATTCTACAATACTTCATGCCCAGAAGCTGAAACCATCTGTATGTCCTTTTNNNNNNN
NNNNNNNAACCAAGATCCAACCCTGGCAGCATCGCTTTTACAGTTGAGTTTCCCTGACTGCTTTGTTCAG
GTTTGCATAAATATTATCTTAAGTTTTTAAGTCGTGATTTGAAATATTTC
ATCCCAAGAGTTTTGTAAAGGTGTGTCCATGACTTCATTCTACTTGCTCAGAGGTTCTTCTGTGGCTGATCCTTTACCTGCAACTGCGAAACTACCTTAGGAAATCGCAATATACCACCT
CTGAGCAGTTAATTGGTTTCATTTTGGTGTGATTTCTGCATTCAATGTTTATATTATGTGTATTTGAACTTATTCGGCAACTAGATCATTAAGCCGGTGCCATATTGTTGACTATTTTTT
TTTCCCAATTTGTCATGTACAACATATAAAATGAATTGCTGATAGAAAATTGTTTATCATTCCTCTTTAAGCTAGTTACACTTTCATTGTACAGATCGAGTTTGTGTGAAATAACAATGG
GATTATATTTCTTCTAATAACTTGGTTTTCGTAGGGCTGTGACGCATTCGTTCTTTTGGACGATACAGAATACCATGTCCGGGAAAAGTCAGCACTGCCTAACTTTCAGTCTCTCCGAGG
ATTTGATGTCATAGACACCATCAAGGTTGAACTAGAAAAGGCTTCCCCTCACACAGTTTCATGCTCGGATGTCCTTTATTATCATATC
TAATTGAAAACACAAAAGAGCCGAGGAATAAA
AACAGGCAAGCTATTGTTATTTGGACTGGACAGTCCTGCCAGATAATCAGCAACCCTATATACTTCTCTAAACACATGGATTACATTCACACTACACATCAATCTTACAGTTCCTTTAAT
TGGCGCTATTAAGTTTGCGCAGTACAATGGGAATTCTCATTTTCTCTTGATAATAGTGATTGCCCTTAGGGTCCGTGGCCACTACAACATTTCGCAAATTAGTTCTCTGGCATTCCTGTA
GACCACTTCAACTGCCTTTAACTCTTGTACAAAAGCACTGATCTCACTATACTTCCTAGTATAGTCAGATACTAGGCAGCTAACTTTATTTTGAGTCTTCTGGGAAGTTCCATTGTGCTT
ACGCCAATGTTAGTAAATTGTTAGTAACCCAACGTTCATGCCAGAGCAAAGTCCTTTCTCCATTAGCAATGCTACAAGTTATGAACTTTCATCCTAGTCTACAAGCTCTAATTATAGACC
TCCATGTCCACGAGCAGTCTACCGGAATTCCCATAGACCAGAAACTACAAATGCAATATAATAATTTTGAAACTTCAAAATAAAAAATTAGGATATAAAAGGAACTGATTATAGAAGCAG
AGTGTTGGTAGTGTTTGTATTTGGTTTGTTTTTCATTGTTGTTCATCTAGCTAATGTTGAGTACTGATGATTACCTCTATTACTAATTACTAGCTCACAAGTGTTCTGTAACTTTGATGT
ATATGTCACTTTGTTAATGACATGCCAATTACTAATAATGTGTATCTAAGTTCAGAATGGATATACATCTGTCTTATATGGCCAGTTCATCATCATATCTAAACATTGAAATTAGATGAT
ATACTGCATGCAGTTAACACTTGTGTTTTGGTCTGTATATGCAGTCAGGAGGACCTAAATGGAGCATTGAGTTCGGCAGGAGAGAGAGAGAGCTTTGTGGCAAATAACACAGCTGTCTTT
CAGGGACTTCCAAATCCAAATTCTGAGCTTGCAGATCTGTTCGCAAAATTTGAGCAAGCAGGTATGAACCTTAAAGATATGGTAGGCCTCTCAGGAGGGCATACCATA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTTTTCTTCTGTTGCTTAATGCTACTGCTTCTTCGTCAGCCTAATTCCACTTTAAGTGCAGAATTCTACAATACTTCATGCCCAGAAGCTGAAACCATCTGTATGTCCTTTTNNNNNNN
NNNNNNNAACCAAGATCCAACCCTGGCAGCATCGCTTTTACAGTTGAGTTTCCCTGACTGCTTTGTTCAG
GGCTGTGACGCATTCGTTCTTTTGGACGATACAGAATACCATGTCCGGGA
AAAGTCAGCACTGCCTAACTTTCAGTCTCTCCGAGGATTTGATGTCATAGACACCATCAAGGTTGAACTAGAAAAGGCTTCCCCTCACACAGTTTCATGCTCGGATGTCCTTTATTATCA
TATC
AATGGAGCATTGAGTTCGGCAGGAGAGAGAGAGAGCTTTGTGGCAAATAACACAGCTGTCTTTCAGGGACTTCCAAATCCAAATTCTGAGCTTGCAGATCTGTTCGCAAAATTTGA
GCAAGCAGGTATGAACCTTAAAGATATGGTAGGCCTCTCAGGAGGGCATACCATA

Retrieve as FASTA