Entry information : AcoPrx[P]78 (AcoGoldSmith_v1.021992m)
Entry ID 8645
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-07-03 (Qiang Li)
Peroxidase information: AcoPrx[P]78 (AcoGoldSmith_v1.021992m)
Name (synonym) AcoPrx[P]78 (AcoGoldSmith_v1.021992m)
Class Class III peroxidase     [Orthogroup: Prx027]*
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx[P]78
start..stop
S start..stop
AfpPrx04 225 9e-74 1..194 169..365
AcoPrx09 225 1e-73 1..194 169..365
AfpPrx02 207 2e-67 1..192 120..311
AcoPrx05 207 1e-66 1..192 174..365
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1667183..1667348 166 N° 2 1667891..1668306 416  
join(1667183..1667348,1667891..1668306)


exon

Literature and cross-references AcoPrx[P]78 (AcoGoldSmith_v1.021992m)
DNA ref. Phytozome 12:   scaffold_20 (1667183..1668306)
Protein sequence: AcoPrx[P]78 (AcoGoldSmith_v1.021992m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   189
PWM (Da):   %s   21424.86  
PI (pH):   %s   9.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SGGPYYHLTTGRRDSLASFADIVASEVTSPQDDLSKTLTSYASKGFDERETVSLLGAYSIGVAHCHFFRSHL*LFSDWLT*PFSGT*ISSSDEVKMSCMR*QQESHRGFRDEYGL*RRNRTRVWYKILRVQGKDILHADQQLMVGEQTASWVKTYASDKSLFRRDFAQVMMKLSSLRVLTKPLGQIRLNCLRV

Retrieve as FASTA  
Remarks 5' end is missing. Stops in frame. Gaps in frame.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCTGGTGGTCCTTACTATCACCTGACCACTGGAAGGAGAGACAGTCTTGCATCTTTTGCTGATATCGTGGCTTCTGAGGTCACTTCTCCTCAGGATGATCTTTCCAAGACCCTTACATCC
TATGCTAGTAAAGGATTTGATGAAAGAGAGACTGTCAGTCTCTTAG
GTAAGCTGACTGTTCTATCTTCTATGAGCTTAATGAAATCATTAGATTTAATTTAGTATCTTATGTGTACATTC
TGTTACTTTTAGTAACATGGGCTTCACTATTCAGCATTAAGCGAGATTATTGATCTTGTTTTCTGTTTTCGACAAAAGAAATCACTATTGTTATTATTTTGAAAAAGGGATTTATTAGTC
TTTTCAATCTGTAGTTGGATAAAAGTTGGTTTGCCTCAGGTTAAGGGTTTTTGACATTCTGTTTAATTTTTAGACTATAGCTATTTTTCCTTTTCTCTTAGTAAGTTGTTTACTCATTGC
TGTTGTCAATGGAGCTAAAAATGCGCATTCAACTAATTTGTCCTGTTCATTAGTTATAACTTATAATGTTGTTGACTCCGGAGTAAATGGATGTATCTGATAAAATTTAATTTTCTAATA
CATTTGGCAGTCTGGTCATTAAAACGAAGTTAATAAATACTGATCTTGTTGATGGACCTAAATTTACTTAAATGTGATTTTTGACAAACTGTAATTGGTGTTCATCAGGTGCTTACAGTA
TAGGAGTAGCTCACTGCCACTTCTTCCGCAGCCACCTATGACTTTTCAGTGACTGGCTTACCTGACCCTTCTCTGGAACCTGAATTTCTTCATCTGATGAGGTCAAGATGTCATGTATGC
GATGACAGCAAGAGTCACACAGAGGATTCAGGGATGAATATGGGCTATGACGGAGAAACAGGACCAGAGTTTGGTACAAAATACTACGGGTGCAAGGAAAGGATATTCTTCATGCTGATC
AGCAGTTGATGGTTGGGGAACAAACTGCAAGCTGGGTCAAAACCTATGCGTCAGACAAATCATTGTTCCGCAGGGACTTTGCCCAAGTGATGATGAAGCTTTCAAGCCTTCGAGTCCTGA
CAAAACCACTAGGACAGATAAGGCTCAATTGTTTGAGAGTTGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCTGGTGGTCCTTACTATCACCTGACCACTGGAAGGAGAGACAGTCTTGCATCTTTTGCTGATATCGTGGCTTCTGAGGTCACTTCTCCTCAGGATGATCTTTCCAAGACCCTTACATCC
TATGCTAGTAAAGGATTTGATGAAAGAGAGACTGTCAGTCTCTTAG
GTGCTTACAGTATAGGAGTAGCTCACTGCCACTTCTTCCGCAGCCACCTATGACTTTTCAGTGACTGGCTTACC
TGACCCTTCTCTGGAACCTGAATTTCTTCATCTGATGAGGTCAAGATGTCATGTATGCGATGACAGCAAGAGTCACACAGAGGATTCAGGGATGAATATGGGCTATGACGGAGAAACAGG
ACCAGAGTTTGGTACAAAATACTACGGGTGCAAGGAAAGGATATTCTTCATGCTGATCAGCAGTTGATGGTTGGGGAACAAACTGCAAGCTGGGTCAAAACCTATGCGTCAGACAAATCA
TTGTTCCGCAGGGACTTTGCCCAAGTGATGATGAAGCTTTCAAGCCTTCGAGTCCTGACAAAACCACTAGGACAGATAAGGCTCAATTGTTTGAGAGTTGCT

Retrieve as FASTA