Entry information : AcoPrx[P]81 (AcoGoldSmith_v1.022906m)
Entry ID 8646
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-07-03 (Qiang Li)
Peroxidase information: AcoPrx[P]81 (AcoGoldSmith_v1.022906m)
Name (synonym) AcoPrx[P]81 (AcoGoldSmith_v1.022906m)
Class Class III peroxidase     [Orthogroup: Prx104]*
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx[P]81
start..stop
S start..stop
AcoPrx72 565 0 1..317 1..319
AcoPrx65 523 0 1..317 1..315
AcoPrx106 518 0 1..317 1..319
AcoPrx94 508 0 1..306 1..307
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2353886..2354098 213 N° 2 2354123..2354308 186 N° 3 2354419..2354970 552  
join(2353886..2354098,2354123..2354308,2354419..2354970)


exon

Literature and cross-references AcoPrx[P]81 (AcoGoldSmith_v1.022906m)
DNA ref. Phytozome 12:   scaffold_29 (2353886..2354970)
Protein sequence: AcoPrx[P]81 (AcoGoldSmith_v1.022906m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   312 (284)
PWM (Da):   %s   33339.52 (30578.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.72 (8.72) Peptide Signal:   %s   cut: 29 range:29-312
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSTSSVLSIGLVMVLLTTFSLPAALAQLSVSYYASTCPSVFDTVRSATLCHQ*RWSNGSFHYVK*YL*SLQGCDGGILLSGGERNAPGNIAMVRGYYVIDSIKA*VDRACGRSVVSCADILAISSRDSIVELGGPSYSVP*GRRDTRTPNIAGARSDLPAFFHDLPRIIDIFQRKGFSEREMVALSGAHPIGQAQCSSFRDRFYSNTSNIDPAFAVSRQATCPRSGGDGNLAPLDPQSPGRFGNNYFQALMNRRGLLNSDQVLFNGGSTDSIVRTYANAASAFSTDFMNAMVKMGNLSPLTGTQGEIRTTCQRVN

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGCAGTACTAGTTCAGTTCTCTCAATAGGTCTTGTTATGGTCCTTTTAACCACCTTTTCCTTACCAGCTGCTTTAGCACAGCTTTCAGTCTCCTACTATGCCAGTACATGCCCA
TCAGTTTTTGATACTGTTCGGTCAGCCACACTCTGTCATCAATAGAGATGGTCGAATGGGTCCTTCCATTATGTTAAGTAGTATTTATGATCT
AATTAAGGTGCATGGCTTTCATGGCTT
CAGGGTTGTGATGGAGGAATTCTATTGTCTGGCGGTGAAAGAAATGCCCCAGGCAATATTGCTATGGTAAGAGGGTATTATGTTATTGATAGCATAAAGGCATAGGTTGATAGAGCATGT
GGGCGTAGTGTAGTTTCATGTGCAGACATCCTAGCCATTAGTAGCCGAGACTCCATTGTTGAA
GTAAGTAAACTAACTGGCGTTGATTGAATGAATTTAGATAATGGAATTCAAAAACAT
AATTGTATTCCCATATATATTAGTTATAACCAAAATTTCATTTTGTATCTCAGCTTGGAGGACCAAGTTATTCAGTTCCATAAGGAAGGAGAGATACAAGAACTCCAAACATTGCAGGAG
CAAGAAGCGATCTCCCCGCCTTCTTTCACGATCTTCCAAGGATCATAGACATATTTCAACGTAAAGGCTTTAGTGAACGAGAAATGGTAGCTTTATCTGGAGCACACCCAATCGGCCAAG
CCCAATGCTCTTCTTTTAGAGATCGATTCTATAGTAATACTAGCAACATCGATCCCGCATTCGCAGTGTCTAGGCAGGCAACTTGTCCTCGTAGTGGTGGAGATGGCAACTTAGCACCAC
TAGACCCTCAAAGCCCAGGTCGTTTTGGAAACAATTATTTCCAGGCATTGATGAACAGAAGAGGACTTCTTAACTCTGATCAGGTGTTGTTTAACGGTGGCTCGACCGATTCTATTGTAA
GGACATATGCCAATGCTGCTAGTGCCTTTTCAACAGATTTCATGAATGCAATGGTTAAAATGGGGAACTTAAGTCCCTTAACTGGTACTCAAGGCGAGATACGCACAACTTGTCAAAGGG
TAAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGCAGTACTAGTTCAGTTCTCTCAATAGGTCTTGTTATGGTCCTTTTAACCACCTTTTCCTTACCAGCTGCTTTAGCACAGCTTTCAGTCTCCTACTATGCCAGTACATGCCCA
TCAGTTTTTGATACTGTTCGGTCAGCCACACTCTGTCATCAATAGAGATGGTCGAATGGGTCCTTCCATTATGTTAAGTAGTATTTATGATCT
CTTCAGGGTTGTGATGGAGGAATTCTA
TTGTCTGGCGGTGAAAGAAATGCCCCAGGCAATATTGCTATGGTAAGAGGGTATTATGTTATTGATAGCATAAAGGCATAGGTTGATAGAGCATGTGGGCGTAGTGTAGTTTCATGTGCA
GACATCCTAGCCATTAGTAGCCGAGACTCCATTGTTGAA
CTTGGAGGACCAAGTTATTCAGTTCCATAAGGAAGGAGAGATACAAGAACTCCAAACATTGCAGGAGCAAGAAGCGATCTC
CCCGCCTTCTTTCACGATCTTCCAAGGATCATAGACATATTTCAACGTAAAGGCTTTAGTGAACGAGAAATGGTAGCTTTATCTGGAGCACACCCAATCGGCCAAGCCCAATGCTCTTCT
TTTAGAGATCGATTCTATAGTAATACTAGCAACATCGATCCCGCATTCGCAGTGTCTAGGCAGGCAACTTGTCCTCGTAGTGGTGGAGATGGCAACTTAGCACCACTAGACCCTCAAAGC
CCAGGTCGTTTTGGAAACAATTATTTCCAGGCATTGATGAACAGAAGAGGACTTCTTAACTCTGATCAGGTGTTGTTTAACGGTGGCTCGACCGATTCTATTGTAAGGACATATGCCAAT
GCTGCTAGTGCCTTTTCAACAGATTTCATGAATGCAATGGTTAAAATGGGGAACTTAAGTCCCTTAACTGGTACTCAAGGCGAGATACGCACAACTTGTCAAAGGGTAAAT

Retrieve as FASTA