Entry information : SbPrx88 (Sobic.005G104100.1 [2.1] / SB05G009400 [1.4])
Entry ID 865
Creation 2005-12-25 (Christophe Dunand)
Last sequence changes 2005-12-25 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx88 (Sobic.005G104100.1 [2.1] / SB05G009400 [1.4])
Name (synonym) SbPrx88 (Sobic.005G104100.1 [2.1] / SB05G009400 [1.4])
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Seedlings
Inducer Heat shock stress
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx88
start..stop
S start..stop
ZmPrx45 585 0 30..341 33..345
SiPrx110 572 0 4..341 3..339
BdiPrx118 513 0 17..341 10..331
OsPrx133 502 1e-180 31..341 27..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18669847..18670278 432 N° 2 18670361..18670523 163 N° 3 18670682..18671112 431  
join(18669847..18670278,18670361..18670523,18670682..18671112)


exon

Literature and cross-references SbPrx88 (Sobic.005G104100.1 [2.1] / SB05G009400 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_5 (18669847..18671112)
EST ref. GenBank:   CD204861 [5' end]
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.6278.1
Protein sequence: SbPrx88 (Sobic.005G104100.1 [2.1] / SB05G009400 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341 (308)
PWM (Da):   %s   35691.15 (32416.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.13 (5.38) Peptide Signal:   %s   cut: 34 range:34-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATRRCSSSNVPPAGLLAVPCLLLLLLAGVSNGQLQVGFYSNSCPGAESTVASVVRQSGSADPTILPALIRLQFHDCFVRGCDASVLIKGGAGGNNAEVDNSKHQGLRGVEIIEGAKTQLEALCPGVVSCADIVVLAARDAISFTGGPSFDVPTGRLDGKVSNLRDADALPDVHDGIDALRSKFRANGLDEKDLVLLTAAHTVGTTACFFLQDRLYNFPLPGGGRGSDPTIPPGFLSELKSRCAPGDLNTRLALDRGSEGVFDTSILRNIRNGFAVIGSDAALYNDTATVDVVDSYSGLLSNFFGPYFRQDFADAMVRMGSIGVVTGRKQGEVRKVCSKFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, introns 2 and 3) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACCAGAAGGTGTAGTAGTAGCAACGTGCCACCTGCAGGCTTATTGGCCGTGCCATGCTTGCTGCTGCTGCTGCTCGCCGGCGTCTCCAACGGGCAGCTCCAGGTGGGGTTCTAC
TCCAACTCCTGCCCCGGCGCCGAGTCCACCGTCGCCTCCGTCGTCCGGCAGTCCGGGTCCGCCGACCCCACCATCCTCCCGGCGCTCATCCGCCTCCAGTTCCACGACTGCTTCGTCCGC
GGCTGCGACGCCTCGGTGCTCATCAAGGGCGGCGCCGGCGGCAACAACGCCGAGGTGGACAACAGCAAGCACCAGGGCCTCCGCGGCGTGGAGATCATCGAGGGCGCCAAGACCCAGCTC
GAGGCCCTGTGCCCCGGCGTCGTCTCCTGCGCCGACATCGTCGTCCTCGCCGCCCGAGACGCCATCTCCTTC
GTACGTACACTTCCACTACTACCGCTATCTATGTGCACATTGATAACT
GAGCTCTGACCGATGACCGTCGGCGTGGATGCAGACCGGCGGGCCGTCGTTCGACGTGCCGACGGGGCGGCTCGACGGGAAGGTGTCCAACCTGCGTGACGCCGACGCGCTGCCGGACGT
GCACGACGGCATCGACGCGCTCCGTTCCAAGTTCCGCGCCAACGGACTCGACGAGAAGGACCTCGTCCTCCTCACCG
GTACGCACGAATGCATCGATAGATCTCGCTGCTCTTTTTCCTT
GAATGCATGCACGATCGACGGACGCGCGAACTGAACACGTGCATATATATATGCATGTATATATATATATATATATATATATATATATATATATATATATATGATGATGATGCAGCTGCG
CACACGGTGGGGACGACGGCGTGCTTCTTCCTGCAGGACCGGCTGTACAACTTCCCGCTGCCCGGCGGCGGCCGGGGCTCGGACCCGACCATCCCGCCGGGGTTCCTGTCGGAGCTCAAG
TCGCGGTGCGCGCCGGGGGACTTGAACACGCGGCTGGCGCTGGACCGGGGCAGCGAGGGCGTGTTCGACACCTCGATCCTCCGGAACATCCGGAACGGGTTCGCCGTGATCGGCTCCGAC
GCGGCGCTCTACAACGACACGGCGACCGTCGACGTCGTGGACTCCTACTCCGGCCTGCTCAGCAACTTCTTCGGGCCCTACTTCCGGCAGGACTTCGCGGACGCCATGGTACGCATGGGC
AGCATCGGCGTGGTCACCGGCCGGAAGCAGGGCGAGGTCCGGAAGGTCTGCTCCAAGTTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACCAGAAGGTGTAGTAGTAGCAACGTGCCACCTGCAGGCTTATTGGCCGTGCCATGCTTGCTGCTGCTGCTGCTCGCCGGCGTCTCCAACGGGCAGCTCCAGGTGGGGTTCTAC
TCCAACTCCTGCCCCGGCGCCGAGTCCACCGTCGCCTCCGTCGTCCGGCAGTCCGGGTCCGCCGACCCCACCATCCTCCCGGCGCTCATCCGCCTCCAGTTCCACGACTGCTTCGTCCGC
GGCTGCGACGCCTCGGTGCTCATCAAGGGCGGCGCCGGCGGCAACAACGCCGAGGTGGACAACAGCAAGCACCAGGGCCTCCGCGGCGTGGAGATCATCGAGGGCGCCAAGACCCAGCTC
GAGGCCCTGTGCCCCGGCGTCGTCTCCTGCGCCGACATCGTCGTCCTCGCCGCCCGAGACGCCATCTCCTTC
ACCGGCGGGCCGTCGTTCGACGTGCCGACGGGGCGGCTCGACGGGAAG
GTGTCCAACCTGCGTGACGCCGACGCGCTGCCGGACGTGCACGACGGCATCGACGCGCTCCGTTCCAAGTTCCGCGCCAACGGACTCGACGAGAAGGACCTCGTCCTCCTCACCG
CTGCG
CACACGGTGGGGACGACGGCGTGCTTCTTCCTGCAGGACCGGCTGTACAACTTCCCGCTGCCCGGCGGCGGCCGGGGCTCGGACCCGACCATCCCGCCGGGGTTCCTGTCGGAGCTCAAG
TCGCGGTGCGCGCCGGGGGACTTGAACACGCGGCTGGCGCTGGACCGGGGCAGCGAGGGCGTGTTCGACACCTCGATCCTCCGGAACATCCGGAACGGGTTCGCCGTGATCGGCTCCGAC
GCGGCGCTCTACAACGACACGGCGACCGTCGACGTCGTGGACTCCTACTCCGGCCTGCTCAGCAACTTCTTCGGGCCCTACTTCCGGCAGGACTTCGCGGACGCCATGGTACGCATGGGC
AGCATCGGCGTGGTCACCGGCCGGAAGCAGGGCGAGGTCCGGAAGGTCTGCTCCAAGTTCAACTGA

Retrieve as FASTA