Entry information : CclPrx37 (clementine0.9_015630m)
Entry ID 8657
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx37 (clementine0.9_015630m)
Name (synonym) CclPrx37 (clementine0.9_015630m)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx37
start..stop
S start..stop
CsPrx28 672 0 1..327 1..327
EgrPrx67 536 0 1..327 1..325
EgrPrx68 536 0 1..327 1..325
EglPrx68 536 0 1..327 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2808887..2809099 213 N° 2 2808581..2808778 198 N° 3 2807782..2807947 166 N° 4 2806976..2807382 407
complement(join(2806976..2807382,2807782..2807947,2808581..2808778,2808887..2809 099))


exon

Literature and cross-references CclPrx37 (clementine0.9_015630m)
DNA ref. Phytozome 12:   scaffold_4 (2809099..2806976)
Protein sequence: CclPrx37 (clementine0.9_015630m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (303)
PWM (Da):   %s   36295.39 (33735.1) Transmb domain:   %s   i5-24o
PI (pH):   %s   9.11 (9.11) Peptide Signal:   %s   cut: 25 range:25-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
METKSFFIILSSVVFSLIMTGASAQLREDFYRSTCPNVESLVRSAVTKKFTQTFVTAPATLRLFFHDCFVRGCDASVLLSSPNNRAEKDHPEDISLAGDGFDTVVKAKEAVDSDPQCRNKVSCADILALATRDVVSLAGGPFYKVELGRRDGRISTIASVQHRLPQPDFNLDQLNRMFSSHGLDQTDMIALSGAHTIGFSHCSRFSKRIYNFSPRNRIDPTLNFNYAMQLRGMCPVRVDPRIAIDMDPTTPRIFDNAYYKNLQQGKGLFTSDQILFSDGRSRDTVVRFASNKEAFNRAFISAITKLGRVGVKTGNQGEIRRDCALVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAACTAAAAGCTTCTTCATTATTCTGTCATCTGTTGTTTTCTCTCTCATAATGACAGGTGCTTCTGCTCAACTTCGTGAAGACTTTTATAGAAGCACCTGCCCAAATGTAGAATCG
CTTGTACGCTCGGCAGTCACCAAGAAGTTCACTCAGACCTTTGTCACAGCCCCAGCAACTCTTAGACTCTTTTTCCACGATTGCTTTGTCCGG
GTAATCAGTGAGCCTATTTATTATCTA
AATCATATTGATTTTTAATGATGGTTAATGGCTGAGCTATATCTTGGGTTTCTTCTTACATATGCTGTTTGTGCTTGATAGGGATGTGATGCTTCAGTGCTGCTATCGTCGCCGAATAAT
CGGGCAGAGAAGGATCACCCAGAAGATATATCACTAGCTGGAGATGGATTTGATACTGTGGTCAAAGCTAAGGAAGCTGTTGATAGTGATCCTCAGTGCAGAAACAAAGTTTCATGTGCT
GATATTTTAGCTCTTGCCACTAGAGATGTTGTTTCCTTG
GTATGCATTCTTTTCTCATTCACTAATTGTCCATTTGCATGTGGAGTTTTTAACAAATAAAATTTCTCTCTCACCTAAAAA
GAGTAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTGAATGAGAGGTACATTAGACTTTTTCTCTTTGTTACTTAGATTCCACATGGAAAAAGGCTAAAAGAAAAAG
GTTAACCATTACTCATTATTATTGTTAAAAAATAATTTTGGGTGTTTTCGATGTCTACTCTTTTATTTATTGAATTTTATCATGTAATTATCTTTACATAATTACTTTTGACGTAGCATT
CCTTTTCTTATTGAACTTTTATTATGCATATAGTTTTTTGTTTTTTACATAATTGATTAATTGAGTATACAGCCACAGTATGAATCTAATAAATAAGAGAGTATATATGAAAAGCATCCA
CTGATTTGTTGGGTTAAATACTATGATCCCTCATTACATTTTCCCATTTCAATAATTGAATAAATTATCTAAGACTACTCCAACTGCTACAATTCTATGATTGAGTCTTGAGAGTTTTCA
TATTAGTTTATAACTTTATTATATTCATAATTATATGCTTTTGGTGACTAAAATACAAGAATATAAATGCAGGCAGGGGGACCATTCTATAAAGTTGAATTGGGGAGGCGTGATGGCAGA
ATATCGACAATAGCAAGTGTTCAGCACAGACTTCCTCAACCTGATTTTAATTTAGACCAACTCAACAGAATGTTCAGCTCACATGGTCTCGATCAAACGGACATGATTGCATTATCAG
GT
ATGTTTATATCTCCACTGAACTACCACTATGGAGAATGACTTTTCATTCTTTGAGAATTCTTTATAAATTTTTAAGACCCCATTTCGTTCTTCGTTCTTGGCATTAAAATGTTGATTAAA
AAAAAAAAAAACATATTGTTGAAAGTCAATGTAACTTTTTAATGAACACATATTAACTAGTTTTAATTTCTACGTTAAAATGTCATATTTATCTTTTATTTTGTTTGTTCACATTTCAAT
ACAAGATGATAACTATAACAAATGTTAAAGTAATGAAATCTTAACCGTATATATTGTNNNNNNNNNNNNNNNNNNNNAACACTTGAAAGTGTGAACTCAAATAAAAAGAAAATCTTTAAC
TCCGGTGTAATATTGACTTACCGAACATTTTTTTCAGGTGCACATACGATAGGATTCTCTCACTGCAGTCGCTTCTCGAAAAGAATCTACAACTTCAGCCCCAGGAACAGAATCGATCCC
ACTTTAAATTTCAATTATGCAATGCAGCTGAGGGGCATGTGCCCTGTAAGAGTTGATCCTAGAATTGCCATTGACATGGACCCTACGACGCCTCGAATTTTCGACAATGCTTACTACAAG
AATCTTCAGCAGGGAAAGGGTTTGTTTACGTCTGATCAAATTTTGTTTTCTGATGGAAGATCAAGAGACACAGTTGTTCGATTTGCTTCCAACAAAGAAGCTTTTAATAGGGCCTTTATT
TCTGCTATTACAAAGCTTGGACGTGTGGGAGTCAAGACAGGAAATCAAGGAGAAATTCGAAGGGATTGCGCGCTTGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAACTAAAAGCTTCTTCATTATTCTGTCATCTGTTGTTTTCTCTCTCATAATGACAGGTGCTTCTGCTCAACTTCGTGAAGACTTTTATAGAAGCACCTGCCCAAATGTAGAATCG
CTTGTACGCTCGGCAGTCACCAAGAAGTTCACTCAGACCTTTGTCACAGCCCCAGCAACTCTTAGACTCTTTTTCCACGATTGCTTTGTCCGG
GGATGTGATGCTTCAGTGCTGCTATCG
TCGCCGAATAATCGGGCAGAGAAGGATCACCCAGAAGATATATCACTAGCTGGAGATGGATTTGATACTGTGGTCAAAGCTAAGGAAGCTGTTGATAGTGATCCTCAGTGCAGAAACAAA
GTTTCATGTGCTGATATTTTAGCTCTTGCCACTAGAGATGTTGTTTCCTTG
GCAGGGGGACCATTCTATAAAGTTGAATTGGGGAGGCGTGATGGCAGAATATCGACAATAGCAAGTGTT
CAGCACAGACTTCCTCAACCTGATTTTAATTTAGACCAACTCAACAGAATGTTCAGCTCACATGGTCTCGATCAAACGGACATGATTGCATTATCAG
GTGCACATACGATAGGATTCTCT
CACTGCAGTCGCTTCTCGAAAAGAATCTACAACTTCAGCCCCAGGAACAGAATCGATCCCACTTTAAATTTCAATTATGCAATGCAGCTGAGGGGCATGTGCCCTGTAAGAGTTGATCCT
AGAATTGCCATTGACATGGACCCTACGACGCCTCGAATTTTCGACAATGCTTACTACAAGAATCTTCAGCAGGGAAAGGGTTTGTTTACGTCTGATCAAATTTTGTTTTCTGATGGAAGA
TCAAGAGACACAGTTGTTCGATTTGCTTCCAACAAAGAAGCTTTTAATAGGGCCTTTATTTCTGCTATTACAAAGCTTGGACGTGTGGGAGTCAAGACAGGAAATCAAGGAGAAATTCGA
AGGGATTGCGCGCTTGTGAACTAA

Retrieve as FASTA