Entry information : CclPrx110 (clementine0.9_033671m)
Entry ID 8671
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx110 (clementine0.9_033671m)
Name (synonym) CclPrx110 (clementine0.9_033671m)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx110
start..stop
S start..stop
CsPrx21 671 0 1..328 1..328
EgrPrx43 507 0 11..328 6..321
EcamPrx43 506 0 11..328 6..321
MePrx120 504 0 13..328 13..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2169017..2169235 219 N° 2 2169354..2169545 192 N° 3 2170080..2170245 166 N° 4 2170501..2170910 410
join(2169017..2169235,2169354..2169545,2170080..2170245,2170501..2170910)


exon

Literature and cross-references CclPrx110 (clementine0.9_033671m)
DNA ref. Phytozome 12:   scaffold_20 (2169017..2170910)
Protein sequence: CclPrx110 (clementine0.9_033671m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (302)
PWM (Da):   %s   35324.72 (32273.0) Transmb domain:   %s   i7-26o
PI (pH):   %s   7.94 (7.31) Peptide Signal:   %s   cut: 27 range:27-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMSPKWSVHVFVILIVVLLCTIVNSQLQVGFYRNSCSSAELIVKDEVRKSVLKDKGVAAGLVRMHFHDCFVRGCDASVLIDSTSSNTAEKDSPVNNPSLRGFEVIDNAKAALESVCKGIVSCADIVAFAARDSVEISGGLGYDVPSGRRDGRISLASEALTNLPPPTFTVNQLTQSFANKGFTQEEMVTLSGAHTIGRSHCTSFSNRLYNFSGTMSQDPSLNPMYAAQLKQQCPQDGTNPNLVVPMNPGSPSIADTGYYIDILRNRGLFTSDQTLLSDPETASQVNQNAKTPKLWKTNFAAAMVKMGQIGVLTASAGEIRANCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATGAGTCCAAAGTGGTCCGTTCATGTTTTTGTTATTTTGATTGTGGTTTTGTTATGCACAATTGTAAATTCTCAGCTTCAAGTAGGGTTTTATCGAAATTCATGTAGCTCAGCA
GAACTTATTGTGAAAGATGAGGTTAGAAAAAGTGTCCTTAAAGATAAAGGAGTGGCTGCTGGTCTTGTGAGAATGCATTTTCATGATTGCTTTGTTAGG
GTAATGTAACTATTAATTTAT
ATTTGCACTTACAAGTTTCTTTTTTTTTTTTTTTTGGATCATTTATATGACGACGCAATAAAGTAACTTAAAGATCTTCGTTGGTTCTGTTTATAAGGGTTGTGATGCATCAGTGCTGAT
CGACTCCACTTCTTCAAACACAGCCGAGAAAGACTCTCCTGTCAATAACCCTAGTCTGCGAGGGTTTGAAGTCATCGACAATGCAAAGGCTGCCCTAGAATCTGTTTGTAAAGGAATTGT
ATCATGTGCTGACATTGTTGCATTTGCGGCAAGGGACAGTGTGGAGATA
GTAAGCAGAGATAAATTTAATGTTTTGTCCTTCAGGACATTAATTAGCTAATTTTAGGTCCATTTGACTCA
ACTATTTAGTAAAACCACAGCTCTAAAATATTTAGGAAAAGAATTCCAATTTTACACTCATCTTGTCTTTGGCTAACCTTTTTGGATCCCCTTATTTGTGGATGATAAAATAAAAACAAT
AAAATGATAATTCTAAACCATATGTATATATTCGACTAATAATGTACACGAGTTGCAAGATCTTTAAAAGGTAAGTGAAAGACAAGATGAAAAAATGATCCATTTCCTTGAACAACACTT
ACACAAGTAGTTGAAAGTTGATTAGGTGATTTTAATTCATATTTGTTTGGTTTTAAAAAAAAAACACTTATGTTATCTTTACTATTTTTGTTGAAAATATTATTTTAGATCATATTTATC
AAACATTAATTAATTATCACCTTGTAATTTACCACAGCTGTGGCCTTTATACTACCAAACAATGCCTTAGTTTGCTTGATGCCATATAACATTTTGTTTGCAGAGTGGTGGGCTGGGCTA
TGATGTTCCTTCAGGAAGAAGAGATGGAAGAATTTCACTAGCCTCTGAGGCATTAACCAATCTACCTCCCCCTACATTCACTGTCAACCAACTCACTCAATCCTTCGCAAACAAGGGCTT
TACACAAGAAGAAATGGTTACACTTTCTG
GTAATTAATTATATAAATTTTCTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACTATACATCCAGAAATGATTTATTATATACATAAAAT
AAAACATAATTTTAGTTAATGTAAAATCCATATAACATATACAGGAGCACACACCATTGGACGCTCTCACTGTACTTCCTTCAGTAACAGATTATACAATTTCAGTGGCACAATGAGTCA
GGACCCAAGCTTAAATCCCATGTATGCTGCTCAGTTGAAGCAGCAGTGCCCCCAAGACGGTACCAATCCGAACTTAGTGGTGCCAATGAATCCTGGGAGTCCAAGCATCGCTGACACTGG
GTACTACATTGATATCTTGAGGAATCGTGGTTTGTTCACATCAGACCAAACTCTGTTGTCAGACCCAGAAACTGCAAGCCAAGTAAACCAAAATGCTAAAACTCCGAAGCTTTGGAAGAC
AAATTTTGCTGCTGCTATGGTGAAGATGGGCCAAATTGGTGTCTTAACGGCTAGTGCTGGCGAAATTCGAGCAAACTGTAGAGTTGTTAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATGAGTCCAAAGTGGTCCGTTCATGTTTTTGTTATTTTGATTGTGGTTTTGTTATGCACAATTGTAAATTCTCAGCTTCAAGTAGGGTTTTATCGAAATTCATGTAGCTCAGCA
GAACTTATTGTGAAAGATGAGGTTAGAAAAAGTGTCCTTAAAGATAAAGGAGTGGCTGCTGGTCTTGTGAGAATGCATTTTCATGATTGCTTTGTTAGG
GGTTGTGATGCATCAGTGCTG
ATCGACTCCACTTCTTCAAACACAGCCGAGAAAGACTCTCCTGTCAATAACCCTAGTCTGCGAGGGTTTGAAGTCATCGACAATGCAAAGGCTGCCCTAGAATCTGTTTGTAAAGGAATT
GTATCATGTGCTGACATTGTTGCATTTGCGGCAAGGGACAGTGTGGAGATA
AGTGGTGGGCTGGGCTATGATGTTCCTTCAGGAAGAAGAGATGGAAGAATTTCACTAGCCTCTGAGGCA
TTAACCAATCTACCTCCCCCTACATTCACTGTCAACCAACTCACTCAATCCTTCGCAAACAAGGGCTTTACACAAGAAGAAATGGTTACACTTTCTG
GAGCACACACCATTGGACGCTCT
CACTGTACTTCCTTCAGTAACAGATTATACAATTTCAGTGGCACAATGAGTCAGGACCCAAGCTTAAATCCCATGTATGCTGCTCAGTTGAAGCAGCAGTGCCCCCAAGACGGTACCAAT
CCGAACTTAGTGGTGCCAATGAATCCTGGGAGTCCAAGCATCGCTGACACTGGGTACTACATTGATATCTTGAGGAATCGTGGTTTGTTCACATCAGACCAAACTCTGTTGTCAGACCCA
GAAACTGCAAGCCAAGTAAACCAAAATGCTAAAACTCCGAAGCTTTGGAAGACAAATTTTGCTGCTGCTATGGTGAAGATGGGCCAAATTGGTGTCTTAACGGCTAGTGCTGGCGAAATT
CGAGCAAACTGTAGAGTTGTTAACTAG

Retrieve as FASTA