Entry information : CclPrx112 (clementine0.9_034045m)
Entry ID 8673
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2013-12-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-12-23 (Christophe Dunand)
Peroxidase information: CclPrx112 (clementine0.9_034045m)
Name (synonym) CclPrx112 (clementine0.9_034045m)
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx112
start..stop
S start..stop
CsPrx23 555 0 1..323 1..323
CclPrx103 554 0 1..323 1..323
CclPrx97 550 0 1..323 1..323
CclPrx117 521 0 1..323 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1188528..1188962 435 N° 2 1188225..1188368 144 N° 3 1187697..1188084 388  
complement(join(1187697..1188084,1188225..1188368,1188528..1188962))


exon

Literature and cross-references CclPrx112 (clementine0.9_034045m)
DNA ref. Phytozome 11:   scaffold_15 (1188962..1187697)   scaffold_9 (11743819..11742561)
Protein sequence: CclPrx112 (clementine0.9_034045m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (294)
PWM (Da):   %s   34585.67 (31444.1)  
PI (pH):   %s   8.81 (9.33) Peptide Signal:   %s   cut: 30 range:30-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLSETNKFTCTIIVSMLLLIISTQCEAQLSPTFYDATCPSALNTIRMGIRNAVSRERRMAASLIRLHFHDCFVQGCDAFILLDDSSSIDSEKNALPNFKSARGFDIIDSAKSQLERVGPRVVSCADIVAVAARDASFAVSKSSWTVKLGRRDSTAASRSIAENLPSFTDGLDKLISTFATKLIALSGIxPPSSGAHTIGQAQCAFFRDRIYNIxSNIDAGFASTRRRQCPANGGDSNLSPLDLVTPISFDNNYFKNLIQKKGLLASDQVLFSGGSTDSIVDEYSKNPSKFKSDFGHxLRWQIISPLTGAAGKIRRVCNLVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end and PS in frame are missing which have been completed; 3' is missing which can not be found in genomic).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCTCTTTCTGAAACAAATAAGTTTACGTGTACAATTATTGTCTCCATGTTGTTGTTGATTATCTCTACGCAATGTGAAGCACAACTCTCACCAACATTCTACGATGCCACTTGCCCAAG
TGCCCTCAACACAATCCGAATGGGCATTAGAAATGCTGTTTCACGAGAGCGTAGGATGGCGGCATCCCTCATTCGCCTCCATTTTCATGATTGCTTCGTTCAAGGTTGTGACGCGTTCAT
TTTGTTGGACGATTCCTCCTCCATTGACAGCGAGAAAAATGCACTTCCAAATTTTAAATCAGCTAGAGGGTTCGATATTATAGATAGTGCCAAGTCTCAACTGGAGAGAGTTGGCCCTAG
AGTTGTTTCATGCGCTGATATCGTTGCTGTTGCAGCCCGTGATGCTTCTTTCGCTGTGAGTAAATCATCATTAAT
TTTCTACAAGATTAAAACAATAAGAGACATAGTGCTAACAGAAAC
AGTGATAAGCCGATGCCGTTCTGTGCTATTAATCTTGATATATAATTCATTGTTAGTTCTGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAGTTGGAGGACCATCATGGACAGTTAA
GCTTGGTAGAAGAGACTCAACAGCTGCAAGCAGAAGCATAGCAGAAAACCTCCCCAGCTTTACAGATGGCTTGGACAAACTTATTTCCACCTTCGCTACCAAACTTATTGCCCTTTCAGG
TATCNNNCCCCCCTCTCC
CCCTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATATTTGTCTTGTCCTAATGTATATAAAAAATAATATTGGTTAATTAACTATGTCTAAGTAAT
CNNNNNNNNNNNNNNNNNNNNNGTTTCATTTGAAATTCAGGAGCTCATACAATTGGCCAAGCACAATGTGCATTTTTCCGTGATAGGATTTATAACATCAANAGCAATATTGATGCTGGA
TTCGCGAGCACACGAAGGCGTCAGTGCCCGGCTAATGGTGGCGACAGCAATCTATCACCACTTGATTTGGTGACACCCATTTCTTTCGATAACAATTACTTCAAGAATCTCATTCAGAAG
AAGGGTCTTCTCGCATCAGACCAAGTTCTTTTTAGTGGTGGATCTACTGATTCCATCGTTGATGAATATAGCAAAAACCCTTCAAAATTTAAATCTGATTTTGGCCATGANTTAAGATGG
CAGATTATCAGTCCTCTCACGGGCGCTGCTGGAAAAATTCGAAGAGTTTGCAATCTTGTCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCTCTTTCTGAAACAAATAAGTTTACGTGTACAATTATTGTCTCCATGTTGTTGTTGATTATCTCTACGCAATGTGAAGCACAACTCTCACCAACATTCTACGATGCCACTTGCCCAAG
TGCCCTCAACACAATCCGAATGGGCATTAGAAATGCTGTTTCACGAGAGCGTAGGATGGCGGCATCCCTCATTCGCCTCCATTTTCATGATTGCTTCGTTCAAGGTTGTGACGCGTTCAT
TTTGTTGGACGATTCCTCCTCCATTGACAGCGAGAAAAATGCACTTCCAAATTTTAAATCAGCTAGAGGGTTCGATATTATAGATAGTGCCAAGTCTCAACTGGAGAGAGTTGGCCCTAG
AGTTGTTTCATGCGCTGATATCGTTGCTGTTGCAGCCCGTGATGCTTCTTTCGCTGTGAGTAAATCATCATTAAT
AGTTAAGCTTGGTAGAAGAGACTCAACAGCTGCAAGCAGAAGCAT
AGCAGAAAACCTCCCCAGCTTTACAGATGGCTTGGACAAACTTATTTCCACCTTCGCTACCAAACTTATTGCCCTTTCAGGTATCNNNCCCCCCTCTCC
AGGAGCTCATACAATTGGCCA
AGCACAATGTGCATTTTTCCGTGATAGGATTTATAACATCAANAGCAATATTGATGCTGGATTCGCGAGCACACGAAGGCGTCAGTGCCCGGCTAATGGTGGCGACAGCAATCTATCACC
ACTTGATTTGGTGACACCCATTTCTTTCGATAACAATTACTTCAAGAATCTCATTCAGAAGAAGGGTCTTCTCGCATCAGACCAAGTTCTTTTTAGTGGTGGATCTACTGATTCCATCGT
TGATGAATATAGCAAAAACCCTTCAAAATTTAAATCTGATTTTGGCCATGANTTAAGATGGCAGATTATCAGTCCTCTCACGGGCGCTGCTGGAAAAATTCGAAGAGTTTGCAATCTTGT
CAACTAA

Retrieve as FASTA