Entry information : CclPrx116 (clementine0.9_034857m)
Entry ID 8677
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-05 (Qiang Li)
Peroxidase information: CclPrx116 (clementine0.9_034857m)
Name (synonym) CclPrx116 (clementine0.9_034857m)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx116
start..stop
S start..stop
GhPrx05 500 1e-180 5..322 6..323
CpapPrx59 495 2e-178 1..322 1..322
PpePrx24 491 9e-177 1..321 1..323
GmPrx03 487 3e-175 1..322 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1009032..1009232 201 N° 2 1008719..1008901 183 N° 3 1008436..1008598 163 N° 4 992142..992563 422
complement(join(992142..992563,1008436..1008598,1008719..1008901,1009032..100923 2))


exon

Literature and cross-references CclPrx116 (clementine0.9_034857m)
DNA ref. Phytozome 12:   scaffold_78 (1009232..992142)
Protein sequence: CclPrx116 (clementine0.9_034857m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (302)
PWM (Da):   %s   34523.51 (32263.3)  
PI (pH):   %s   5.03 (4.91) Peptide Signal:   %s   cut: 21 range:21-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALFYALLFALVFLIRYSAGQLKIGFYSETCPEAESIVSSVVQDAVVSDPNLAAVLLRLHFHDCFVEGCDGSILIENGPNAEKHAFGHQGVGGFEVVEKAKARSEDACPGVVSCADIVALAARDAIALSNGPSYQVPTGRRDGEVSNVTLADDMPDVSDSIQQLKTKFLHKGLSEKDLVLLSAAHTIGTTACFFMTKRLHNFFPGGGSDPGINPSFVVELKATCPQNGDVNVRLPIDRGSERVFDKQILQNIKDGFAVLESDSRLNDDIITNAIIDSYLGILNPIFGPSFEADFVESIVKMGHIGVKTGQQGHVRRLCAAFS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome(Exon 1 and exon 2 are missing which have been completed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCTATTTTATGCATTGCTGTTTGCATTAGTATTTTTAATCCGCTACTCTGCTGGGCAGCTCAAAATCGGCTTTTATTCTGAAACATGCCCTGAAGCAGAGTCTATTGTCAGTAGT
GTAGTTCAAGATGCAGTTGTCTCAGACCCCAACTTGGCCGCAGTCTTGCTTAGGCTCCATTTCCATGATTGCTTCGTTGAG
GTCTTCTGTAACCATAATTATTTCTGCCTGTCTTTTTTC
TTTTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAAACTGTTTGCTAGGGGTGCGATGGATCAATTCTAATAGAGAA
CGGTCCAAATGCTGAGAAGCATGCATTTGGTCACCAAGGTGTTGGAGGGTTTGAAGTAGTAGAAAAAGCCAAGGCCCGCTCGGAAGATGCATGCCCAGGAGTTGTGTCTTGTGCAGATAT
TGTGGCCTTGGCAGCTCGAGATGCTATAGCTCTA
GTTTGTTTAACTCCNNNNNNNNNNNNNNNNNNNNNNNCATCTAATTTCTTTACATTTAAGCTATCGTACGTACGCTATCGTCAATT
AAAGATTAATATAATTAATAATTGATGAATGCAGTCAAATGGACCGAGCTACCAGGTTCCAACCGGGCGCAGAGATGGTGAAGTTTCAAATGTTACGCTGGCAGATGATATGCCCGATGT
TAGTGATTCAATTCAGCAACTCAAGACTAAGTTTTTGCACAAAGGGCTATCGGAGAAGGATCTAGTACTTCTTAGCG
GTATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNATGCATCTCTAATGACAATATGGTTGGTGGACACTCTGATTAAAATGATCAGGTATCATTAAGGCCAATTCTAAATATATGCATGNNNNNNNNNNNNNNNNNNNNNNNGAAAG
TTAGAATAATCGCATTATAAAAAATCTCAGAAAATTACAAGTAAATTCCGATGGAAAAATTGTCATCCATACAAAAGAATCAGAATAACACAAAATTTACTGCTCACAACTAAGACATGA
CAAATACAAAAAACCGACTTTGGCACTATGCATATAACGAATCTGATTTGATAATTAATAGAGATAAATCAAACTAACTAGCAATTCGTAAGCCAAAGGCAAGACCACCGCCTCACCGAA
AGTAACATCATTCAAATAGTTATCTGAAAAGTTCATACAAAGACCGACACTACTGGGCCATTAAATCTCCAAGCACTTCCATTGGAGTCGACCCAACCGCCTCCAACACGAGTGTATCAT
CCCAATTCGAACACTAAAGTTGAAAGAATTGAGGGAGAAAAGAGGACATGCCTCGGCCCATTGTTGATTTAAAGCCCAGGTCCTCACTTGTTCGGGAAAATTTCCAACCCAATTATTTTT
AACAGTTAAACAAAAATTTATTTTGAAATGTTTTGGTGGCCGTATGAATTGTGTTGATTAGAACTAGAAATGGATGTATTTAGAAAAAAAAAAGATAAAAATTAAAAACTAGGCTTAGGC
CATAGTATCTTCTCTGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCCACTCATTGTGGTGGGAAAAGCTATTTATGGTACGACAAAATTATAACAATAAAATCACATCA
AAATCCAACATTATTATGACCGTTCAGTGCTAGACCTATATGAATATTTTTTTCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGCATCATCAC
TAAATCAATCATCATATTGAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCATAGTGAATTTGGTTTAATGAATGAAAATAATAACAAATCCCAAATTTACTAT
GCTGACACAAAATTGAATTGAATCACCCAAATCCTCTAACTACCACTGAGATTTGTCACCAACAATACAATATTGCAATATGCTTAATCCCAATCACTAACATGATCGGCATGTGTTTGT
AGCTGTTTGCACGTGTTACAACCCAATAAGTATCTGCTTGTGATAGTAAAATTGTTTGCATCTCGCTGCTTACATGCACGCAATGTTAGATTCTCACAATGATTTAAGATCTCATTGCTT
GCGATTGTTTTTGGAGGAAGTTTCCTTTCACTATTTTTCTCTCTCTAATACCCCCGAGATGGTAGGGTTAGGTTGGATCCCTGCTTCTAATACNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNGAGGGACATAATCCAATACCTTCAACTCCAAGAGTAGATACAAGGAAAATGTATAAAAGCTCACCGAGAAGAAAAAGATAATAAAACAATTNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNGCATGTCTCCTAATATGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAAACCTTAAGAAAAGAANNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTATTCCCTTAAAAGTTTAGGAGAT
GCCTATCTTCTGAATTATCATGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATAATATTAAAATTCCCTCTCATAATCNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCAAGCCATCCATATTATCAATCATTGCATCATAAGGGGCAGAGGTTCGATTCTCCTCAGAAACAAACAAAAATCATGCATCCT
CCCCTAATTCATCCGAAAAGCTGCAACTGTATCAAATATAGACAAACCTAAACGATTGTCACTTTCCTCAAAACCCAAAATTGTAGTCACTACCCTAAAAAACATCATAAAAAATATAGT
ACAGTGCAAATTGAGGGCCATCTGCAACTGCACAGTATACTCAATGAGCATTGTACATGCACCTTAGTCAATCATGACAACATTGCTATCAGTAGCCATAGAAACTCAAGTCTGGGCAAT
TAATTCAGTCTCCGTGTCCTGATCAGAAGGAATATGAGTAAAAGTATACAAAGAAACCTCACTAGAAACCATAAGCCCCAACAATCGGATCTCCTTAGTAGGATTAATCTGCAAACCAGA
CCCAAAATTCTATACCTAAACCAAAACAAGTTGTGCACTAGGCCCCTGAGATTTATTTTCAGCAATAACAACATGTTGAGGAATATGAACCACTCAACAGCATCAAAAGTAGGCTTCATC
ACATTATCCATAAACACTTTATCCTAAGGTTCATAAAATAGGCTATTGGGCCCTCTGCAGCCCAAGGTTATTCAGATAACAAGCTCAAGAAAAGTAACTGAGGTACTATAAGAGGGTACC
TCTTTAAAAATAACATTATCCTAAAATCTAAAGTTGATTTTACTAACCCATAGAAGTGGTAATAAAGAACACAAAACGTCGTATTCAACCAAAACTTTAGCAACAGATGACCTATCACAA
AGGCTGCAACGTGATCTACATGTAATGACTTTTCAATAACTGAAGCAATCGAGAATAGAGCGATTTCATAATTAATAAAATGAATAGGTAAATATAGAAAAGATATTGAAATTAGCACAA
TCGAAGATACCTCAGAACATTAAAAATCAGTTATCCACTTAAAAAGATGCATACCTCTACTATTAATGTACAAGGTATGCCAAATCCAAATTTTGGAATAATCTTCTTCCATCTCAAGCT
TGATAATAATATATCCATTATCCAACAAGGAAACTTGGGAGTTTCCCTTTAACTTAAAAAGACATAAAAAACTTGTGAATGATATCCATTGCTGGTGGCCAAAGGAGGACTTACGAACAA
GTGATAATTTATAAGCTTTTACCATGGACCAAATTTTCTTAGTTGAAAAGTGAATAGCAAATTCTCCCCAGTAGAGCAGAATTGACTCAATAGGGGTGAAAGGAGCTGAACAGACGGCAA
CAATATCAATAAAGGATTTTGAAGGGCGATTTCAGGCATTGTGACAAAAGATAGATGCAGGATTAACTACAAAGGTGTATAAAGGTTTGAGAAGAGTGCGGTTTTGATGACTGGTAGCTA
TTGATTGATTTTGAGCGGTCGTTTTTTCTTTCTTTTTAGAAGACCACCATGGGACCCCTACCTGTAATATAGATTATTAACTGACAAATACAAATAGAGAGAGTATAAACTAAAACCTCA
AAGTCATCTAAGAGAAATACAATAGAGTATAAAAAATCCAAGAGCAAGAATCAAATGCGAACTAGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCTCTTAACATGAGGGTTTTCCTGCGCGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGTTTATTTTTTAGACTAGGAGTGAAGAGTGTGAATTCTTTCTATTCCAATATTTGCTTTAATAAAT
TAAGAAAGAATTAAGAATCTCACTCTATGAGCCCCACTCATTTTTTGAGTGGGGAGTGAGAGTGGGACTGCCGTGAGGAGAGGTGGGAGTCCACTCCCTCCTCTTCTTTTTCTACCNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCTTCTTTTTAT
TAAATTTACTATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTAACTTTGTAATTAAAAACTATAATTCTTTAAATAAGGATAA
AATTGTAATTTAAAACTATTTACTCCCGATTCAAGACAAAGTAAACACATAAATTGGATTATGATCTCCATTCCATGCTTCCATTATAGTGCAAGTAAACAACCTACTCTCACTCTCATT
TCACACTCTCAATCCTAGGATTCCCACTTTAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATGAAATTACCACCAAAGCTTTA
ACTCGAGAGCCTTAGACAAATTAGCAAATGATGAAAAGCCCAAACCACCCTTTTTAACCAGATAACAAATTGAGCCATCTATCTCTTAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATATATATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGTTGAGA
TTAAAAAAATAATTACATTACAAAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNTGGTTGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTATATTAGAAAAAAAAAAGTTAATTACCCAGTTTGA
TTCAACAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCAAAAAAAACTCATTAATTGCACTTAGATGTAACTTTTTATAATGTTTTCTCNNNNNNNNNNNNNNNNNNNNNGAGTAGGGG
TAACAATATATTTTATAACTAATTTTAGGGATAGAAATGTCATTTAATAATTAATTGTAGGGGTAAAAATGTTATTTTGTAATTAATTTATTGTCCTCGTTAAAGTTAACAACAAAGTTA
ACGGATTGTCACCTGATCAAGTATTTTAAAAAAACGTGTCACCTTTTAAAAATTTGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGGGGTGGGTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNGNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCATGAGAATAAAAACGATCTGAACCCCATAAAGAAACTTAGCAGTCATAATAAACAAGCATATGAAAAGAG
GACCACCCTACCCTACCCAAGATCATCTTGAGATTGGAAAAATCAGTGGCTAACCTAATTCACCACCATCGAGCACCGGGCCTAAAAATAACTCTTTGAATCAGAGAAATCCGCTGCTCT
AAGAATCCAAAACACCTTAACATCTGTATAATAGAAGACTAGGACAACCGATCATACGCTTTGGCCTTCCAACTTCAGCACCACATTGCTCCTCCAAGAACAATGGTTCAAGTCGTGTGA
TGCTGAAGCTTCAGCTGAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAGAGTAATTTTGAAAATAGTAGGGGCTTGTGAGATTATTTGAGGTTCAAATATCATTGTTAGT
TTCGAAAAGGGATTTTCCTTTTTTTTTTTTCCCTTAAAAAAAGTGATTTCAGTTGTGAGTGGTGTCACTGGCAGCCCATCTAGTTTCCTTAAATCATCCCACCCCATGCACCCAGCCCAT
CCCCTCCCATTCACGAGTACACCTTGTGATAAAAAAATTATTAATGGAAACAAATGAAAGACATTTTCTATAGGAAAGAATATAGATTTTTTATGAAAACAATTAATGTAGATGAATGAA
GAATATTGCAAAGGAATTTATCAATGAGAAGCTTCATTTGGTTGACTTGTGACGTGCTGGTTGTGAGCAATGGATTTTACTAAATTAATAGCATTGGGCTTGTGTACGGAATGTCACAAT
TGGTTTTCTTTAAATACAGGAATGTTGGGTCTCATGATTTTCCTTAAGCTTCGAAGATTTTTTTTTTTTCTTGTTCGGTTAACATTAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAATATTCTTATTGCAGATTTTTTTATCATGCTGTC
CTTAGTACATCTCTAATTGTGCCGTGTTTTTAAGGCCCGCGTGTCTAAAATTTTAGAGCCGTGTTGTGCCCTGTACCTCACTGAAACATGCTCGTGTCGTGCCATACTGTATGGACATGA
GCCGTGCCACGTGTTGTTCGGCCTATTGGCCATCTCTAGGTAACATTGATGGATGGACAAAGTCCAAATCATTTTTTTAACCCATATTTTTTTTTTCAAAAACCACTAACTCGACCCCTT
AAAGCTCTTCGATGACAAACATGATCATATCATACTAATAATCCTCATAAATTGCATTAGTTGTTGTAAGACTACAGGAATTTAATATAATTCAATATAAAGGGAAGGTTCCTTAATTTA
GAGTTTTTCTTTTAAAAAATAACTTAATTTTTATCCATTAAATTTACTGAATCTTAAGGTAGATGGATGAAACATAAATACAATTTTTAAATTTAAACCGTTTATTTAGTTGNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGTCATTATTTGATTGATATAAGTGAATTATTTCAACTGAGTAGATACAACATAACTCTATGTAAAATACATGAAATATCA
AGTTACNNNNNNNNNNNNNNNNNNNNNGTCAAGGGAATCTCATAACATAAAAAAGAGATTTAGGTGGAACTTTTCNNNNNNNNNNNNNNNNNNNNNNNNNNCTTTTCAGCTGCGCATACT
ATTGGAACCACCGCATGTTTCTTCATGACGAAACGGCTTCACAATTTTTTCCCTGGTGGCGGATCCGATCCCGGAATCAACCCTAGCTTCGTTGTAGAGCTAAAAGCAACTTGCCCTCAG
AACGGCGACGTTAATGTACGATTACCAATTGATCGTGGAAGTGAGAGGGTATTTGACAAGCAGATTTTGCAAAACATTAAGGATGGCTTCGCTGTTCTGGAATCTGATTCTAGGCTCAAT
GATGACATAATTACCAATGCCATAATTGACTCCTACTTAGGGATTCTAAACCCAATATTTGGTCCATCTTTTGAGGCTGATTTTGTTGAGTCAATTGTGAAGATGGGCCACATTGGTGTC
AAAACAGGGCAGCAAGGTCACGTGAGACGCCTTTGTGCTGCTTTCAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCTATTTTATGCATTGCTGTTTGCATTAGTATTTTTAATCCGCTACTCTGCTGGGCAGCTCAAAATCGGCTTTTATTCTGAAACATGCCCTGAAGCAGAGTCTATTGTCAGTAGT
GTAGTTCAAGATGCAGTTGTCTCAGACCCCAACTTGGCCGCAGTCTTGCTTAGGCTCCATTTCCATGATTGCTTCGTTGAG
GGGTGCGATGGATCAATTCTAATAGAGAACGGTCCAAAT
GCTGAGAAGCATGCATTTGGTCACCAAGGTGTTGGAGGGTTTGAAGTAGTAGAAAAAGCCAAGGCCCGCTCGGAAGATGCATGCCCAGGAGTTGTGTCTTGTGCAGATATTGTGGCCTTG
GCAGCTCGAGATGCTATAGCTCTA
TCAAATGGACCGAGCTACCAGGTTCCAACCGGGCGCAGAGATGGTGAAGTTTCAAATGTTACGCTGGCAGATGATATGCCCGATGTTAGTGATTCA
ATTCAGCAACTCAAGACTAAGTTTTTGCACAAAGGGCTATCGGAGAAGGATCTAGTACTTCTTAGCG
CTGCGCATACTATTGGAACCACCGCATGTTTCTTCATGACGAAACGGCTTCAC
AATTTTTTCCCTGGTGGCGGATCCGATCCCGGAATCAACCCTAGCTTCGTTGTAGAGCTAAAAGCAACTTGCCCTCAGAACGGCGACGTTAATGTACGATTACCAATTGATCGTGGAAGT
GAGAGGGTATTTGACAAGCAGATTTTGCAAAACATTAAGGATGGCTTCGCTGTTCTGGAATCTGATTCTAGGCTCAATGATGACATAATTACCAATGCCATAATTGACTCCTACTTAGGG
ATTCTAAACCCAATATTTGGTCCATCTTTTGAGGCTGATTTTGTTGAGTCAATTGTGAAGATGGGCCACATTGGTGTCAAAACAGGGCAGCAAGGTCACGTGAGACGCCTTTGTGCTGCT
TTCAGCTGA

Retrieve as FASTA