Entry information : CclPrx118 (clementine0.9_035472m)
Entry ID 8679
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2016-01-07 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-07 (Achraf Jemmat)
Peroxidase information: CclPrx118 (clementine0.9_035472m)
Name (synonym) CclPrx118 (clementine0.9_035472m)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx118
start..stop
S start..stop
CsPrx45 660 0 12..335 1..324
PtPrx17 508 0 6..335 5..337
VvPrx19 489 5e-176 5..335 4..333
RcPrx48 488 2e-175 1..335 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5890695..5890946 252 N° 2 5891032..5891223 192 N° 3 5891305..5891868 564  
join(5890695..5890946,5891032..5891223,5891305..5891868)


exon

Literature and cross-references CclPrx118 (clementine0.9_035472m)
DNA ref. Phytozome 12:   scaffold_7 (5890695..5891868)
Protein sequence: CclPrx118 (clementine0.9_035472m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (314)
PWM (Da):   %s   36159.79 (33654.5)  
PI (pH):   %s   4.27 (4.18) Peptide Signal:   %s   cut: 22 range:22-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MANNHLGFYLLMLLKIVTTFAIPPKTLKEACIGEIGFELQFNIYNDSCPEAEAIIFSWVENAVMEDSRMAASLLRLHFHDCFVNGCDASVLLDDTGDFVGEKTAPPNLNSLRGFEVIDAIKSDLESVCPETVSCADILAVAARDSVVLTAGPSWEVPMGRRDSFSANKAAATNGIPAPNSSLADLVAKFQNVGLTLQDMVALSGAHTMGKARCSTFSSRLQSSSNTNGPDNNPDFLQSLQQLCSGSDIDALAQLDLVTPATFDNQYYINLLSGEGLLPSDQILVSQDQTREIINSYAKDTSVFFEDFKISMLKMGSLGPASGNDGEIRRNCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Introns 1 and 2). Incorrect prediction from phytozome (a short 5' end is missing MANNHLGFYLL and splicing error intron 1). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAATAATCACCTAGGCTTTTATCTTCTCATGTTACTTAAGATTGTAACCACATTTGCAATCCCACCAAAAACTTTGAAAGAAGCATGTATTGGGGAAATTGGCTTTGAATTGCAA
TTTAACATTTACAATGATAGCTGCCCAGAGGCAGAGGCTATAATCTTTTCTTGGGTTGAAAATGCTGTTATGGAAGATTCAAGAATGGCGGCCTCACTGCTTCGTCTTCATTTTCATGAT
TGCTTTGTCAAT
GCAAGTCGTCTCCGTATTTATTTATATTTCTGTCATCTATTATGTATATTGATTTATAATGTTATGGCATTTGAAGTTCATGCAGGGTTGTGATGCTTCAGTGCTGTT
AGATGACACCGGGGACTTTGTTGGAGAAAAAACTGCACCACCTAATCTGAATTCACTGAGAGGATTCGAAGTCATAGATGCAATAAAATCTGATCTTGAATCTGTTTGTCCTGAGACTGT
CTCTTGTGCTGACATTCTCGCAGTTGCGGCAAGAGACTCAGTTGTTTTA
GTATGTGATGTTCCATCCACTTTGTGCTCCACCATAATGATAATATTTCCAGTTCCGCTGAAACTGAAATG
TATTTTGCAGACTGCTGGTCCAAGCTGGGAAGTGCCAATGGGCAGGCGAGACAGCTTTAGTGCAAACAAAGCTGCAGCAACCAACGGCATCCCAGCTCCAAATTCTAGTCTCGCAGATCT
CGTGGCCAAGTTCCAGAACGTTGGCCTCACGCTGCAAGACATGGTTGCCCTTTCTGGTGCGCACACGATGGGAAAGGCTCGATGCTCGACTTTCAGCTCCAGGCTACAAAGCAGCAGCAA
CACAAATGGGCCAGACAACAATCCAGACTTCCTTCAAAGTCTACAGCAGCTTTGCTCGGGATCCGACATCGATGCACTTGCACAGCTTGATCTGGTGACCCCCGCAACATTCGACAACCA
GTACTACATTAACCTTCTTTCTGGAGAGGGGTTACTTCCATCCGATCAAATTCTCGTGAGCCAAGATCAAACACGCGAAATCATTAATTCATATGCCAAGGACACGTCCGTTTTCTTTGA
GGATTTTAAGATTTCTATGTTGAAGATGGGAAGCCTGGGGCCTGCGTCCGGAAATGATGGTGAAATTCGTCGCAACTGTCGCGTGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAATAATCACCTAGGCTTTTATCTTCTCATGTTACTTAAGATTGTAACCACATTTGCAATCCCACCAAAAACTTTGAAAGAAGCATGTATTGGGGAAATTGGCTTTGAATTGCAA
TTTAACATTTACAATGATAGCTGCCCAGAGGCAGAGGCTATAATCTTTTCTTGGGTTGAAAATGCTGTTATGGAAGATTCAAGAATGGCGGCCTCACTGCTTCGTCTTCATTTTCATGAT
TGCTTTGTCAAT
GGTTGTGATGCTTCAGTGCTGTTAGATGACACCGGGGACTTTGTTGGAGAAAAAACTGCACCACCTAATCTGAATTCACTGAGAGGATTCGAAGTCATAGATGCAATA
AAATCTGATCTTGAATCTGTTTGTCCTGAGACTGTCTCTTGTGCTGACATTCTCGCAGTTGCGGCAAGAGACTCAGTTGTTTTA
ACTGCTGGTCCAAGCTGGGAAGTGCCAATGGGCAGG
CGAGACAGCTTTAGTGCAAACAAAGCTGCAGCAACCAACGGCATCCCAGCTCCAAATTCTAGTCTCGCAGATCTCGTGGCCAAGTTCCAGAACGTTGGCCTCACGCTGCAAGACATGGTT
GCCCTTTCTGGTGCGCACACGATGGGAAAGGCTCGATGCTCGACTTTCAGCTCCAGGCTACAAAGCAGCAGCAACACAAATGGGCCAGACAACAATCCAGACTTCCTTCAAAGTCTACAG
CAGCTTTGCTCGGGATCCGACATCGATGCACTTGCACAGCTTGATCTGGTGACCCCCGCAACATTCGACAACCAGTACTACATTAACCTTCTTTCTGGAGAGGGGTTACTTCCATCCGAT
CAAATTCTCGTGAGCCAAGATCAAACACGCGAAATCATTAATTCATATGCCAAGGACACGTCCGTTTTCTTTGAGGATTTTAAGATTTCTATGTTGAAGATGGGAAGCCTGGGGCCTGCG
TCCGGAAATGATGGTGAAATTCGTCGCAACTGTCGCGTGGTTAATTAA

Retrieve as FASTA