Entry information : CclPrx35 (clementine0.9_015487m)
Entry ID 8695
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx35 (clementine0.9_015487m)
Name (synonym) CclPrx35 (clementine0.9_015487m)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx35
start..stop
S start..stop
CsPrx10 677 0 1..330 1..330
RcPrx17 605 0 1..330 1..330
PbPrx02 594 0 1..330 1..332
LcPrx03 594 0 1..330 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1935462..1935686 225 N° 2 1935780..1935971 192 N° 3 1936057..1936222 166 N° 4 1936321..1936730 410
join(1935462..1935686,1935780..1935971,1936057..1936222,1936321..1936730)


exon

Literature and cross-references CclPrx35 (clementine0.9_015487m)
DNA ref. Phytozome 11:   scaffold_25 (1935462..1936730)
Protein sequence: CclPrx35 (clementine0.9_015487m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (308)
PWM (Da):   %s   36088.23 (33644.0)  
PI (pH):   %s   8.74 (8.94) Peptide Signal:   %s   cut: 23 range:23-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAQLMIFLIAFSLLAFAPLCFCGKSSSGYLYPQFYDHSCPKAQEIVKCIVAKAVAKETRMAASLLRLHFHDCFVKGCDASILLDSSGSIISEKRSNPNRNSARGFEVIDEIKSALEKECPQTVSCADILALAARDSTVLTGGPSWEVPLGRRDSKGASLSGSNNDIPAPNNTFQTILTKFKLQGLDIVDLVALSGSHTIGNARCTSFRQRLYNQSGNGQPDNTLDQSYAAQLRIGCPRSGGDQNLFFLDFVSPTKFDNSYFKNILASKGLLNSDQVLSTKNEASMELVKKYAENNDLFFQQFAKSMVKMGNISPLTGNRGEIRRNCRRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCAGCTTATGATCTTTCTCATTGCTTTTTCTCTCCTTGCCTTTGCCCCTCTTTGCTTCTGTGGCAAGTCCTCCAGTGGTTACCTCTACCCACAGTTTTATGACCATTCCTGCCCA
AAAGCTCAAGAGATAGTGAAGTGCATTGTAGCCAAGGCTGTTGCAAAAGAAACCCGCATGGCTGCTTCATTGCTTAGACTCCATTTCCATGACTGTTTTGTCAAG
GTTAGCTAATTGACA
CAACTTCCTTCCGATCACACTCCATTTAATTTTTAAGTAAAACCCCATTCCTTTTTTTTTTTTTTTTGGGATGTGCAGGGTTGTGATGCATCAATATTACTAGACAGCAGTGGCAGTATA
ATCAGTGAGAAGAGGTCGAATCCCAATAGGAACTCTGCAAGAGGATTTGAAGTCATTGATGAGATCAAGTCTGCTTTAGAGAAGGAGTGCCCTCAGACGGTTTCCTGTGCTGATATTTTG
GCTCTGGCTGCTAGAGATTCCACTGTTTTG
GTAAGTAGTGCTGTAACAATTAGTGCTTTGCCACAAGACCAAGATGGCCTTTCCCATCTAATCAAATCAAATTGTGCAACTGCAGACTGG
TGGACCAAGCTGGGAGGTGCCATTGGGAAGAAGAGACTCCAAAGGTGCAAGCTTGAGTGGCTCAAACAACGACATTCCAGCTCCAAACAACACTTTCCAAACTATTCTAACCAAGTTCAA
GTTGCAAGGACTTGACATTGTCGATCTTGTAGCACTATCTG
GTATTAATAACTGAAACTTGACTAGTTAATTTGTATATGTTATCACTGTTCAGAAACTAGGCATGTGTGTTAAAGCTTC
TACAATTTATTTCATACAGGGAGCCACACAATCGGAAATGCTCGTTGCACTAGCTTCAGGCAGAGACTATACAACCAATCCGGCAACGGTCAACCGGACAACACTCTTGACCAATCATAT
GCTGCCCAATTGCGAATAGGGTGCCCGAGATCCGGTGGTGACCAGAACTTATTTTTCTTGGACTTTGTCAGTCCAACGAAGTTTGATAACAGCTACTTCAAGAATATATTAGCTTCAAAG
GGCCTGTTGAACTCTGACCAAGTTCTCTCAACAAAGAACGAGGCATCAATGGAACTTGTGAAGAAATATGCCGAGAATAATGACCTTTTCTTCCAGCAATTTGCCAAGTCCATGGTTAAG
ATGGGTAACATCTCTCCATTGACTGGTAACAGGGGAGAAATCAGAAGGAACTGCAGGAGGATTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCAGCTTATGATCTTTCTCATTGCTTTTTCTCTCCTTGCCTTTGCCCCTCTTTGCTTCTGTGGCAAGTCCTCCAGTGGTTACCTCTACCCACAGTTTTATGACCATTCCTGCCCA
AAAGCTCAAGAGATAGTGAAGTGCATTGTAGCCAAGGCTGTTGCAAAAGAAACCCGCATGGCTGCTTCATTGCTTAGACTCCATTTCCATGACTGTTTTGTCAAG
GGTTGTGATGCATCA
ATATTACTAGACAGCAGTGGCAGTATAATCAGTGAGAAGAGGTCGAATCCCAATAGGAACTCTGCAAGAGGATTTGAAGTCATTGATGAGATCAAGTCTGCTTTAGAGAAGGAGTGCCCT
CAGACGGTTTCCTGTGCTGATATTTTGGCTCTGGCTGCTAGAGATTCCACTGTTTTG
ACTGGTGGACCAAGCTGGGAGGTGCCATTGGGAAGAAGAGACTCCAAAGGTGCAAGCTTGAGT
GGCTCAAACAACGACATTCCAGCTCCAAACAACACTTTCCAAACTATTCTAACCAAGTTCAAGTTGCAAGGACTTGACATTGTCGATCTTGTAGCACTATCTG
GGAGCCACACAATCGGA
AATGCTCGTTGCACTAGCTTCAGGCAGAGACTATACAACCAATCCGGCAACGGTCAACCGGACAACACTCTTGACCAATCATATGCTGCCCAATTGCGAATAGGGTGCCCGAGATCCGGT
GGTGACCAGAACTTATTTTTCTTGGACTTTGTCAGTCCAACGAAGTTTGATAACAGCTACTTCAAGAATATATTAGCTTCAAAGGGCCTGTTGAACTCTGACCAAGTTCTCTCAACAAAG
AACGAGGCATCAATGGAACTTGTGAAGAAATATGCCGAGAATAATGACCTTTTCTTCCAGCAATTTGCCAAGTCCATGGTTAAGATGGGTAACATCTCTCCATTGACTGGTAACAGGGGA
GAAATCAGAAGGAACTGCAGGAGGATTAATTAA

Retrieve as FASTA