Entry information : CclPrx40 (clementine0.9_015724m)
Entry ID 8697
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx40 (clementine0.9_015724m)
Name (synonym) CclPrx40 (clementine0.9_015724m)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx40
start..stop
S start..stop
CsPrx19 669 0 1..325 1..325
CppPrx13 654 0 4..325 1..322
MePrx24 498 8e-180 1..325 1..325
RcPrx71 497 4e-179 7..325 4..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1056434..1056643 210 N° 2 1056143..1056334 192 N° 3 1055880..1056042 163 N° 4 1055352..1055764 413
complement(join(1055352..1055764,1055880..1056042,1056143..1056334,1056434..1056 643))


exon

Literature and cross-references CclPrx40 (clementine0.9_015724m)
DNA ref. Phytozome 12:   scaffold_79 (1056643..1055352)
Protein sequence: CclPrx40 (clementine0.9_015724m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (302)
PWM (Da):   %s   35529.25 (33106.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.9 (9.10) Peptide Signal:   %s   cut: 24 range:24-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRIDYIGVVFLSLFGVVGLSEAQLQLGFYAKSCPRAEKIVLDYVNKHIHNAPSLAASFLRMHFHDCFVRGCDASVLLNSTGNPERNAVPNQTLTGATFDFIERVKRLVEDACPGIVSCADILTLVTRDSIVATGGPSWKVPTGRRDGRVSIRSEAQNNIPAPTNNFTLLQRSFANQGLDLKDLVLLSGAHTIGVSHCTSVSSRLYNFTGVGDQDPALDSEYAANLKARKCRTPNDNTTLLEMDPGSRKTFDLSYYNLLLKRRGLFVSDASLTTNSFTLSLVKQLLQGSLENFFAEFAKSVEKMGRNKVKTGSEGEIRKRCAFVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGGATAGACTACATTGGTGTCGTATTTTTAAGTCTTTTTGGTGTTGTAGGCCTGAGTGAAGCTCAATTGCAACTGGGATTTTATGCTAAGAGCTGCCCAAGAGCTGAAAAGATT
GTGTTAGACTATGTTAACAAACACATCCACAATGCCCCCTCATTAGCCGCATCTTTCCTCAGAATGCATTTCCATGATTGCTTTGTCAGG
GTTAGCACAATATTTCACCTTTTGGAAGCT
TTGCATAAAACTCTTATCTCCGTTTTACATTTTGTTTCTTGCTGACGCGCGCTTCGCTTTGCATCTCAGGGCTGTGATGCATCCGTGCTGCTAAACTCAACAGGCAATCCTGAAAGAAAT
GCCGTTCCAAATCAAACATTGACAGGCGCAACCTTTGATTTCATCGAAAGAGTGAAGAGACTAGTCGAAGATGCATGCCCCGGCATAGTTTCTTGTGCAGATATTCTTACGTTAGTTACA
AGAGACTCTATTGTAGCCACA
GTAAGCGTTGCATTTTCATTTTCTTCTTGAGACAAGATAATTAATTAACAAGACTACAGAGCTTCTGTTTCTGTCTAATTTTACTTGCTGTTGACTTCA
GGGAGGTCCTTCCTGGAAAGTTCCAACCGGACGAAGAGACGGGCGAGTCTCCATTCGTTCAGAAGCCCAAAACAATATCCCAGCTCCTACTAACAACTTCACCCTTCTTCAACGAAGTTT
TGCTAATCAAGGACTTGATTTGAAGGACCTGGTTCTGCTCTCAG
GTAAGCACAACAACTAAAGTGTTTGGTAATTTTTATTTTTTTTCAATCTTTTAAGTCGTGGCACCGCAATTCTAGA
TGGAACTAAGCTTGACATAAGGCTTTCATGTTGTTTCAGGTGCACACACAATCGGGGTCTCCCACTGCACTTCAGTTTCAAGCCGGCTGTACAATTTCACAGGAGTGGGTGACCAAGACC
CTGCTCTTGACAGTGAATATGCAGCAAATCTCAAGGCAAGAAAGTGCAGAACTCCAAATGATAACACTACATTACTTGAAATGGACCCTGGTAGCCGCAAGACATTTGATCTTAGCTACT
ACAATCTTTTGCTTAAGAGAAGGGGTCTCTTTGTATCTGATGCTTCTTTGACTACAAACTCTTTCACTTTGTCTTTGGTTAAGCAACTTCTTCAGGGATCATTGGAAAATTTCTTTGCTG
AATTTGCCAAGTCTGTGGAGAAAATGGGAAGGAATAAGGTTAAGACTGGATCAGAAGGTGAGATCAGGAAGCGTTGCGCTTTTGTCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGGATAGACTACATTGGTGTCGTATTTTTAAGTCTTTTTGGTGTTGTAGGCCTGAGTGAAGCTCAATTGCAACTGGGATTTTATGCTAAGAGCTGCCCAAGAGCTGAAAAGATT
GTGTTAGACTATGTTAACAAACACATCCACAATGCCCCCTCATTAGCCGCATCTTTCCTCAGAATGCATTTCCATGATTGCTTTGTCAGG
GGCTGTGATGCATCCGTGCTGCTAAACTCA
ACAGGCAATCCTGAAAGAAATGCCGTTCCAAATCAAACATTGACAGGCGCAACCTTTGATTTCATCGAAAGAGTGAAGAGACTAGTCGAAGATGCATGCCCCGGCATAGTTTCTTGTGCA
GATATTCTTACGTTAGTTACAAGAGACTCTATTGTAGCCACA
GGAGGTCCTTCCTGGAAAGTTCCAACCGGACGAAGAGACGGGCGAGTCTCCATTCGTTCAGAAGCCCAAAACAATATC
CCAGCTCCTACTAACAACTTCACCCTTCTTCAACGAAGTTTTGCTAATCAAGGACTTGATTTGAAGGACCTGGTTCTGCTCTCAG
GTGCACACACAATCGGGGTCTCCCACTGCACTTCA
GTTTCAAGCCGGCTGTACAATTTCACAGGAGTGGGTGACCAAGACCCTGCTCTTGACAGTGAATATGCAGCAAATCTCAAGGCAAGAAAGTGCAGAACTCCAAATGATAACACTACATTA
CTTGAAATGGACCCTGGTAGCCGCAAGACATTTGATCTTAGCTACTACAATCTTTTGCTTAAGAGAAGGGGTCTCTTTGTATCTGATGCTTCTTTGACTACAAACTCTTTCACTTTGTCT
TTGGTTAAGCAACTTCTTCAGGGATCATTGGAAAATTTCTTTGCTGAATTTGCCAAGTCTGTGGAGAAAATGGGAAGGAATAAGGTTAAGACTGGATCAGAAGGTGAGATCAGGAAGCGT
TGCGCTTTTGTCAATTAG

Retrieve as FASTA