Entry information : SbPrx64 (Sobic.003G167300.1 [2.1] / Sb03g016510 [1.4])
Entry ID 870
Creation 2008-10-20 (Christophe Dunand)
Last sequence changes 2008-10-20 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx64 (Sobic.003G167300.1 [2.1] / Sb03g016510 [1.4])
Name (synonym) SbPrx64 (Sobic.003G167300.1 [2.1] / Sb03g016510 [1.4])
Class Class III peroxidase    [Orthogroup: Prx308]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Seedlings
Inducer Nitrogen starvation
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx64
start..stop
S start..stop
SiPrx19 563 0 4..323 3..322
BdiPrx41 447 9e-160 1..323 1..323
SiPrx155 443 4e-158 11..323 8..320
SiPrx170 442 1e-157 10..323 9..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26985631..26985840 210 N° 2 26989243..26990004 762  
join(26985631..26985840,26989243..26990004)


exon

Literature and cross-references SbPrx64 (Sobic.003G167300.1 [2.1] / Sb03g016510 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_3 (26985631..26990004)
Protein sequence: SbPrx64 (Sobic.003G167300.1 [2.1] / Sb03g016510 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (302)
PWM (Da):   %s   33805.43 (31741.3) Transmb domain:   %s   i5-27o
PI (pH):   %s   9.15 (9.30) Peptide Signal:   %s   cut: 25 range:22-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSSLTFGVILSCALLLATATHGLQVGYYKKTCPSAEVLVRAAVKKALLANPGVGAGLIRMLFHDCFVEGCDASVLLDPTQENPQPEKLGRPNNPSLRGYEVIDAAKSAVEKACPGTVSCADIVAFAGRDASYLLSNSKVSFHMPAGRLDGRKSLASETGVFLPGPSSNLSSLVSAFAGKGLSAEDMVVLSGAHSIGRSHCTSFVQTRLSAPSDIAASLATLLRKQCPANPTTANDAVVSQDVVSPDVLDNQFYKNVLAHNVLFTSDAVLLSAPNTARMVRANARFAGSWEKKFAKAMVKMAAIGVKTGRDGEIRKNCRLVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, intron 1) and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCAGCAGTTTGACGTTCGGCGTAATACTCTCATGCGCCCTGCTTTTGGCCACGGCGACCCATGGTCTCCAGGTGGGTTACTACAAGAAGACGTGTCCCAGTGCCGAGGTCCTC
GTGAGGGCCGCGGTAAAGAAGGCCCTGCTGGCTAACCCCGGCGTCGGCGCCGGGCTCATCCGCATGCTCTTCCACGACTGCTTCGTCGAG
GTACATCTTGCATTGATCTTCTTTGCTGGT
ATACTAGAACATTGGGCGCCCTTTGGGCGCCCTATCTTGGCCGGATTAAATTAGATACTAAAGTATTTAGTCAAATTTATAAAAATAATTTTCTTTTTTCATAAAAAATAAAATTAAGAA
AATTGCATGTAACATAGTAAGGCACCATTTAGATCCCTTTATTTTAGAGGAATTAGAATCCAATTAATGGGTCAGGCTATTTTGCCTAAAATTTGATATTCTACAAATTTTTCAGGCTCA
CAAATAAACCTATCTCAAATTCATAGGGTGAAGATGGAAATAGATTTTATATATCAGCAGCTATATTTATACCCTTCAACTTATAGCACACTCCTCTTTAACTCATTTCCCTGCAATAGA
AATACAATATAACAAGTATGACCCATGTATGGCTAACAATAATATGCAAATATATTTCATATGCAACCATATTAGCTTAATTAATACATGACTAAATTGTAATTATTATAATGAATTTGA
TTCCAAGGATCCAAATGGGTCCTAATATTCTTGCACAATAAAAGAAAATTAAATCATCAATGTCATCGGGTATATTTGAAAACTCTTACATCAGGCAGCACTATAAAGGGTCATTGTACA
ATCACAGACATCATTTTGGGGGTAAGAACCATAATGAACTTCAAAAGAGTTTGTCCTAAACTTGGTCCAAAACAAAAACTCGTAGAATCTCTAAAATAACGTGAAGTTAACATCAATTTA
TACTCCTAAACTCCTCAACGGCGGCTGTGCATAGGAGTTGCTTGACGACAACAGCAAGTCTTTACCGCATCTTTGTGTTCCTGCTTCAAAACTCGGCAAGACCACTAAACAAAGTTTAAT
CTTATCCGAACTTGAAAAGAAACATCCTACAAGCTATCTAGAAAATTAGCTTTTCGGCAAGTCCAAAATAAGTGGTGACAAGGCCACTGAAATGGTATAGATGATGTACAGAGTTATAGA
GTTATAGGCTGGGTAGCTAATTTTGCCAATATAATGAATGCTAATGATCTTGTAGTGAGCATGTAATTACTGATCATAAAAAATTATAAATACAAGCAGCAAGCTAAAAAACATGGTAAC
AATCACTAAAATATCACACAAAATAAATTGAGCAAATCATATAACAGTATGATATACACTCTACTGAAGACAGGGTATGCACCTATTGTTGTTGTAAGCTAGCATTGGTCCAATTAAAGT
GATAACCATTGATTAAAGAATAAATATGTGCTGACAAATAGTACTATTTTCTTCGATCAAAATATTGTGTGCTCGTGTCTAGGTCAATAACCAATCTATTGTTTACTTCTGAGCTGGTGC
AAAGAAACAACTCAGTTCATTATAATTGTAATTTTAGAACGGTTCAGACTTCTGACATGCTGGCAAACAAGAAAGAGAATAGAAGTATTAAAATCCATCAGGTTATTTTGTCTTGTTCAC
CGGATAGCATTTCAGTTGATTCATGCAGAGTTATAGGTGAAAAAAATGTAAAATTGTATCAGCAATTCAGGGAACACAGAAATACCAACTCTTGAGGACTCAAATCCATCAGGCAAATCC
AGTGGAGGATTGGGGCAGGCTAACACATTGTGTTACTTGCCACCATGAAACTTTACTGTCAGTTAAATCAAGAAGTCTAAGATCTGAAATATGAAAACAATTGTCAGAATAAATGAAAAC
TCAGACTTTAGTGTGAATGCTGAATTAAGCCCCTATAGAAACATCTGGGATACTTCTGTCTCGTCGAGAAGGCACACATCTGTTCTGAATGCAGAGGAAAATATGTAATCAGGGATTGTT
ATTAATGAAATCCAACAAAATACAATGATGGTTGCACAAATATTTACTTTTCTGAAAGGAAGCAACGCGTTGTGACACTAAAATAAATTACAAAGGCACATATTCATGCTAGCTATTATC
ATGCACTGCACTAACCTTGTCATGGATGCGGCAACAGAGGAGAAATTGGAACCAAGGCAATCGAGTCTACAAATTATCAAATCTAATAACTAATCACAATAATCAATCAACGCAAGAAGA
ACTATTTACATTGTTTAAAGTCCACACCTTCAGTGTCTAAACCGCTACTTATCCCTCCTGACACCTTCACATATATTGTCAAGCAGAAAATCTACATGAAAGTTAAGGGCTACAGTCACA
AAACTTTTCAATCAGAGCTGATGTTGTTTGACATTCTGGAGAGGCAATAGAAGCACACAAAAATATCCTTGCTCGAGAAAATTTTATTTCACTTCATATGAATTTGTACCTGCAAAAATA
TTGACACAGGCAACCACCATAAATAGCCTACATGTAAAATTTCTTTAATTTAGTAGACCAGAAGGGGATTCACATGATCAGACGCAAGTTGATTTGAAATAATATGCGCTGGCCACTTGG
TCGTTGTGAAGCTCAACACAGTGACATTGAAGATGCATCACAAATTCACAGGTAAATCAATCAACATTCAGCAAGATTCAAATCAAACTAACCAATCGTGAGCTCACCTGCCAAGAACCA
TGACAAGCATGTCGTGCTGCTAGATCCGATCCAACGCTAGGCTTCAGTTGCCAGATCCACCATGTCGGCAGCCATGAAGCACCAAACCATAAAAACCCATGAGATCAAGTCTAAATCACC
CCCCAACCGAACCCTAGGACTTGAAAGCCCCCACGTTTCTCACCTTGAGCCTCTTTGGGGGAGAGAAGGGGGATGGCGATGGGACTTCCGCCTGATCTGCGCACTACCGGATCTCACAAG
CTCCCTCATGCTACAGAGGTCGCATGGCTTCCCATGCTCAAGCCATGATGGCACTCGTGCCGGGAAGAAGATGGCGTGGGGTGGAGAGGGCAGGGAGGAGCTAGTGCTTCCTTCTCTGGC
GCTGACCATGGCCACCATGCGCGGCCACCCGGTGAGCCGTTGCCCACGGGAGTCGCGCCCCATGGGTCGTGGTGGAGGGCGAGGAGCACGACGGCGAGATGGGATGCGCAGGGGGGCGGC
GCGGCGAGCCGCATCGATGCGTGGGAGCAACCAGAGGAATGAGGAGGGGATTAGCGTTTGCTTGTTTTGAGTGTGGGGGTTCTTTACAAAATGTCCAAGGACTGCGGGTTGATTACTAAA
AAACGGTGGACGTTTTTGCAAAATGAATAGAGACGCGTGTCGCCGCGTGGAGAAGCCAGCAATGCCTCGAATTCTCTCGTGGCTCCAATCTGGAGTGACTTTTAATAACTCCTGATTAGT
AATTGCATCGATGCACGCATGGGATGGACGACGAGAACTGGCACGTCTATATATACACACGTACTCATCCTACACGTACGTGTATGTAATAAGTGTCACTGATGACCAAGCAAATGAGTC
TACTCTGTGCAGGGCTGTGACGCGTCCGTTCTGCTGGACCCGACGCAGGAGAACCCGCAGCCAGAGAAGCTGGGGCGTCCCAACAACCCCAGCCTACGAGGCTACGAGGTGATCGACGCG
GCCAAGAGCGCAGTCGAGAAAGCGTGCCCTGGCACGGTGTCTTGCGCTGACATCGTCGCCTTCGCGGGGCGCGACGCGTCCTACTTGCTCAGTAACTCCAAGGTTAGCTTCCACATGCCG
GCAGGCCGGCTGGATGGACGCAAGTCACTCGCCAGCGAGACAGGTGTATTCCTGCCCGGCCCGTCCTCCAACCTTTCCAGCCTCGTCTCAGCCTTCGCCGGCAAGGGGCTCAGCGCCGAG
GACATGGTCGTGCTCTCGGGCGCGCACTCCATCGGTCGCTCCCACTGCACCTCCTTCGTCCAGACCCGCCTGAGCGCCCCCTCCGACATCGCGGCGTCGCTGGCGACGTTGCTGAGGAAG
CAGTGCCCCGCCAACCCGACCACCGCCAACGACGCGGTGGTGTCCCAGGACGTGGTCAGCCCGGACGTGCTGGACAACCAGTTCTACAAGAACGTGCTGGCACACAATGTGCTCTTCACC
TCGGACGCCGTGCTGCTATCGGCGCCCAACACCGCGAGGATGGTCCGTGCCAACGCCAGGTTCGCGGGCTCCTGGGAGAAGAAGTTCGCCAAGGCCATGGTGAAGATGGCCGCCATTGGC
GTGAAGACCGGCCGTGACGGCGAGATAAGGAAGAACTGCAGGCTCGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCAGCAGTTTGACGTTCGGCGTAATACTCTCATGCGCCCTGCTTTTGGCCACGGCGACCCATGGTCTCCAGGTGGGTTACTACAAGAAGACGTGTCCCAGTGCCGAGGTCCTC
GTGAGGGCCGCGGTAAAGAAGGCCCTGCTGGCTAACCCCGGCGTCGGCGCCGGGCTCATCCGCATGCTCTTCCACGACTGCTTCGTCGAG
GGCTGTGACGCGTCCGTTCTGCTGGACCCG
ACGCAGGAGAACCCGCAGCCAGAGAAGCTGGGGCGTCCCAACAACCCCAGCCTACGAGGCTACGAGGTGATCGACGCGGCCAAGAGCGCAGTCGAGAAAGCGTGCCCTGGCACGGTGTCT
TGCGCTGACATCGTCGCCTTCGCGGGGCGCGACGCGTCCTACTTGCTCAGTAACTCCAAGGTTAGCTTCCACATGCCGGCAGGCCGGCTGGATGGACGCAAGTCACTCGCCAGCGAGACA
GGTGTATTCCTGCCCGGCCCGTCCTCCAACCTTTCCAGCCTCGTCTCAGCCTTCGCCGGCAAGGGGCTCAGCGCCGAGGACATGGTCGTGCTCTCGGGCGCGCACTCCATCGGTCGCTCC
CACTGCACCTCCTTCGTCCAGACCCGCCTGAGCGCCCCCTCCGACATCGCGGCGTCGCTGGCGACGTTGCTGAGGAAGCAGTGCCCCGCCAACCCGACCACCGCCAACGACGCGGTGGTG
TCCCAGGACGTGGTCAGCCCGGACGTGCTGGACAACCAGTTCTACAAGAACGTGCTGGCACACAATGTGCTCTTCACCTCGGACGCCGTGCTGCTATCGGCGCCCAACACCGCGAGGATG
GTCCGTGCCAACGCCAGGTTCGCGGGCTCCTGGGAGAAGAAGTTCGCCAAGGCCATGGTGAAGATGGCCGCCATTGGCGTGAAGACCGGCCGTGACGGCGAGATAAGGAAGAACTGCAGG
CTCGTCAACTAG

Retrieve as FASTA