Entry information : CclPrx43 (clementine0.9_015773m)
Entry ID 8700
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx43 (clementine0.9_015773m)
Name (synonym) CclPrx43 (clementine0.9_015773m)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx43
start..stop
S start..stop
CsPrx20 659 0 1..324 3..326
VvPrx65 531 0 11..324 9..322
PtPrx82 525 0 5..324 3..322
MePrx64 520 0 5..324 4..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 779891..780100 210 N° 2 779277..779468 192 N° 3 778626..779198 573  
complement(join(778626..779198,779277..779468,779891..780100))


exon

Literature and cross-references CclPrx43 (clementine0.9_015773m)
DNA ref. Phytozome 11:   scaffold_5 (780100..778626)
Protein sequence: CclPrx43 (clementine0.9_015773m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (301)
PWM (Da):   %s   34999.33 (32330.0)  
PI (pH):   %s   4.95 (4.92) Peptide Signal:   %s   cut: 24 range:24-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGVMREMMVFLFTILLIMQRGDGQLVENFYSSTCPNVESIVNRVVSTKFSQTFITVPATLRLFFHDCFIVGCDASVLIQSPNGDAEKDAPDNLSLAGDGFDTVVQAKQAVEAQCPGVVSCADILAIAARDVVVLAGGASFSVELGRRDGLVSRASSVKGNLPEPTFNLDELNQMFAKHGLSQIDMIALSGAHTLGFSHCDRFANRIYSFSSSSPVDPSLDPAYAQQLMQACPRNVDPQIAINMDPVTPRTFDNMYYQNLVAGKGLFTSDQVLFTDASSQPTVKDFARNPLDFNAAFATAMRKLGRVGVKTGNQGEIRRDCTAFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGTAATGAGAGAGATGATGGTGTTTTTGTTTACAATTCTTTTGATTATGCAGAGAGGCGATGGGCAATTGGTAGAAAATTTCTACTCGTCAACTTGTCCTAATGTTGAATCCATT
GTGAACAGAGTGGTGTCAACAAAGTTTAGCCAAACGTTCATCACCGTTCCGGCAACTCTCCGGCTCTTTTTCCACGACTGCTTCATCGTG
GTAACTCATTATAACTAGCGTTTATCAAAT
ACTAGATGATCATAAGGTTATATTTTCTGGTTTATAGCAGAAGCAATGTTGTTGTTGTTGGTTTTTTTTTTTTTTTTTAGCAATTAATTTTTAGTAGACGGGTCGTTATTGGAGGCTATC
ACACGTTATAGCTTAGACAAGAACAATTACCAAACCATTTTGACTTGAGAACATAATAGCGAATGGCTTAACATGGAGTTAACAGATTCAAGTACCACAAGCTTGGTCTATATCATTTGA
CAACTCATAGTACAATATAAAGTGGTGGCATGGAAAGAAGAATAGAAAGATGCACACACGTGTTTGACTAGGGTGGCATCTCTTATGGCTTAGGCTACTGTGATAATTAGCGTGGATTAC
AATAATTGGCAACTGAGTTGTTTCTTTGACAGGGATGTGATGCCTCGGTCCTGATTCAATCCCCAAATGGGGACGCGGAGAAGGATGCCCCAGACAACCTTTCCCTTGCAGGAGACGGAT
TTGACACTGTTGTTCAGGCTAAGCAAGCTGTGGAAGCACAGTGCCCCGGCGTAGTCTCTTGCGCAGACATCTTAGCTATTGCTGCAAGGGATGTTGTAGTTCTG
GTAATAAGCATCATTA
TTAACTAGCAACCACTATGTTTCCCACTTTGTGAAGTTAAATTTAATCCGATCAATATGCAGGCTGGAGGTGCTTCATTCAGCGTAGAATTGGGAAGACGCGATGGCCTTGTATCTAGAG
CCTCAAGTGTGAAGGGAAATTTGCCAGAACCAACATTCAATCTTGATGAACTCAACCAAATGTTTGCCAAACACGGCCTCAGCCAAATTGACATGATTGCACTCTCAGGAGCTCACACTT
TAGGCTTCTCTCATTGCGACCGCTTTGCAAACCGCATCTACTCATTCTCTTCATCATCTCCTGTCGATCCTTCATTGGATCCAGCTTATGCCCAGCAGTTAATGCAAGCCTGTCCGCGAA
ATGTTGACCCCCAAATTGCCATCAACATGGATCCTGTAACCCCACGAACATTTGACAATATGTACTACCAGAATCTAGTGGCGGGGAAGGGCTTGTTTACTTCGGATCAAGTGCTATTCA
CTGATGCATCATCTCAGCCTACTGTGAAGGACTTTGCTAGAAACCCTCTTGACTTTAATGCAGCATTTGCCACAGCTATGAGAAAGCTTGGCAGAGTTGGGGTTAAAACCGGAAACCAAG
GAGAAATACGAAGAGACTGCACAGCATTTAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGTAATGAGAGAGATGATGGTGTTTTTGTTTACAATTCTTTTGATTATGCAGAGAGGCGATGGGCAATTGGTAGAAAATTTCTACTCGTCAACTTGTCCTAATGTTGAATCCATT
GTGAACAGAGTGGTGTCAACAAAGTTTAGCCAAACGTTCATCACCGTTCCGGCAACTCTCCGGCTCTTTTTCCACGACTGCTTCATCGTG
GGATGTGATGCCTCGGTCCTGATTCAATCC
CCAAATGGGGACGCGGAGAAGGATGCCCCAGACAACCTTTCCCTTGCAGGAGACGGATTTGACACTGTTGTTCAGGCTAAGCAAGCTGTGGAAGCACAGTGCCCCGGCGTAGTCTCTTGC
GCAGACATCTTAGCTATTGCTGCAAGGGATGTTGTAGTTCTG
GCTGGAGGTGCTTCATTCAGCGTAGAATTGGGAAGACGCGATGGCCTTGTATCTAGAGCCTCAAGTGTGAAGGGAAAT
TTGCCAGAACCAACATTCAATCTTGATGAACTCAACCAAATGTTTGCCAAACACGGCCTCAGCCAAATTGACATGATTGCACTCTCAGGAGCTCACACTTTAGGCTTCTCTCATTGCGAC
CGCTTTGCAAACCGCATCTACTCATTCTCTTCATCATCTCCTGTCGATCCTTCATTGGATCCAGCTTATGCCCAGCAGTTAATGCAAGCCTGTCCGCGAAATGTTGACCCCCAAATTGCC
ATCAACATGGATCCTGTAACCCCACGAACATTTGACAATATGTACTACCAGAATCTAGTGGCGGGGAAGGGCTTGTTTACTTCGGATCAAGTGCTATTCACTGATGCATCATCTCAGCCT
ACTGTGAAGGACTTTGCTAGAAACCCTCTTGACTTTAATGCAGCATTTGCCACAGCTATGAGAAAGCTTGGCAGAGTTGGGGTTAAAACCGGAAACCAAGGAGAAATACGAAGAGACTGC
ACAGCATTTAATTAG

Retrieve as FASTA