Entry information : CclPrx45 (clementine0.9_015853m)
Entry ID 8701
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx45 (clementine0.9_015853m)
Name (synonym) CclPrx45 (clementine0.9_015853m)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx45
start..stop
S start..stop
CsPrx29 644 0 9..322 1..314
RcPrx09 558 0 1..322 1..321
PpePrx26 555 0 1..322 1..321
PtPrx78 548 0 1..322 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2137351..2137557 207 N° 2 2137685..2137864 180 N° 3 2138136..2138295 160 N° 4 2138402..2138823 422
join(2137351..2137557,2137685..2137864,2138136..2138295,2138402..2138823)


exon

Literature and cross-references CclPrx45 (clementine0.9_015853m)
DNA ref. Phytozome 11:   scaffold_9 (2137351..2138823)
Protein sequence: CclPrx45 (clementine0.9_015853m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (302)
PWM (Da):   %s   34815.55 (32548.4)  
PI (pH):   %s   6.66 (6.66) Peptide Signal:   %s   cut: 21 range:21-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEALRLFFMVILVMATSVQSQGGLKAGFYSSSCPGAEAIVRSTVESHFKKDPTVAAGLLRLHFHDCFVQGCDGSVLIAGSSAERSALPNLGLRGFEVIDDAKTQLEASCPGVVSCADILALAARDSVDLSDGPSWQVPTGRRDGRVSSSQGLNLPSPLDSVTVQRQKFAAKGLDDHDLVTLVGAHTIGQTDCQFFRYRLYNFTTTGNADPSISQSFLAQLQTLCPKDGDGTKRVALDIDSQNKFDVSFFKNVRDGKGVLESDQRLWEDAATRNIVQNYAGTIRGLLGFRFDFEFPKAMIKMSSIEVKTGSDGEIRKICSKFN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAGCTTTACGATTGTTTTTTATGGTGATATTGGTAATGGCTACGTCAGTACAAAGCCAAGGAGGATTGAAAGCCGGGTTCTATTCTTCATCGTGCCCAGGGGCTGAGGCCATAGTT
AGGTCAACTGTTGAATCACACTTTAAGAAAGATCCCACCGTAGCGGCTGGCTTGCTGAGGCTTCATTTCCACGACTGCTTTGTTCAG
GTTGACTCTATTGGATGTCTTGAAATTGAAGAA
CAATTGTATATTGTTATTAGAGGTTGCATGATATCATGCACGTATACTATATAAGCTAGCTTGGGGCGTAATTAATTCAAATTTGTTATTGCAGGGTTGCGATGGTTCAGTCTTGATAGC
TGGGTCTTCTGCTGAGAGGAGTGCGTTGCCTAACCTTGGCTTAAGAGGATTTGAAGTAATCGATGACGCAAAAACACAACTCGAGGCATCCTGTCCTGGTGTAGTCTCCTGTGCTGATAT
ACTAGCACTTGCTGCTCGTGACTCTGTGGACTTG
GTATGCTAACTTTGATCGGCTGATTTTTTTTTTAAGGATCTTATGCCATGCACTTATGCAATAACCACAGATCATGTTAGATATAT
GATATTCAATAACTACCAATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTATGATTTTACGAAAAGATGAGCACAAATTAAGTTAAAATCAACACTGAACCCAAATACGATTTCTATA
TATCTGAATCTGAACTGGCGTGTTTTTTGAAATGGGGACTTGTGCTGTGTGTTTTCACATGCAAGAGCGATGGACCAAGTTGGCAAGTGCCAACAGGAAGAAGAGATGGCAGAGTTTCAT
CATCGCAAGGTTTAAACTTACCTTCTCCTCTCGATTCCGTTACCGTCCAGAGGCAAAAATTTGCTGCTAAAGGCCTTGATGATCATGATCTAGTGACCCTAGTTG
GTAACGCTCTGATAT
TATAATGTCTTTCTGTGTGTGTATATGTGGTATCATAAATAAATCGTCAAGACAATTAATTTACTAAACGTATTAGATTTTATGGCCGCAGGGGCACATACAATTGGGCAAACAGACTGT
CAATTCTTCCGATATCGTCTGTACAACTTCACAACAACAGGCAATGCGGATCCCAGCATTAGCCAGTCGTTCTTGGCACAACTGCAGACCCTTTGTCCCAAAGATGGTGACGGCACAAAA
CGTGTAGCACTAGATATAGATAGCCAGAACAAATTTGATGTGAGCTTCTTCAAGAATGTACGTGATGGTAAAGGAGTTTTAGAGTCCGACCAAAGGCTGTGGGAAGATGCTGCGACACGC
AATATCGTGCAAAACTATGCAGGCACCATTAGGGGGTTGCTTGGTTTTAGGTTTGATTTTGAATTTCCGAAAGCTATGATCAAAATGAGTAGCATCGAAGTGAAGACTGGCTCGGATGGG
GAGATAAGAAAGATATGTTCGAAGTTCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAGCTTTACGATTGTTTTTTATGGTGATATTGGTAATGGCTACGTCAGTACAAAGCCAAGGAGGATTGAAAGCCGGGTTCTATTCTTCATCGTGCCCAGGGGCTGAGGCCATAGTT
AGGTCAACTGTTGAATCACACTTTAAGAAAGATCCCACCGTAGCGGCTGGCTTGCTGAGGCTTCATTTCCACGACTGCTTTGTTCAG
GGTTGCGATGGTTCAGTCTTGATAGCTGGGTCT
TCTGCTGAGAGGAGTGCGTTGCCTAACCTTGGCTTAAGAGGATTTGAAGTAATCGATGACGCAAAAACACAACTCGAGGCATCCTGTCCTGGTGTAGTCTCCTGTGCTGATATACTAGCA
CTTGCTGCTCGTGACTCTGTGGACTTG
AGCGATGGACCAAGTTGGCAAGTGCCAACAGGAAGAAGAGATGGCAGAGTTTCATCATCGCAAGGTTTAAACTTACCTTCTCCTCTCGATTCC
GTTACCGTCCAGAGGCAAAAATTTGCTGCTAAAGGCCTTGATGATCATGATCTAGTGACCCTAGTTG
GGGCACATACAATTGGGCAAACAGACTGTCAATTCTTCCGATATCGTCTGTAC
AACTTCACAACAACAGGCAATGCGGATCCCAGCATTAGCCAGTCGTTCTTGGCACAACTGCAGACCCTTTGTCCCAAAGATGGTGACGGCACAAAACGTGTAGCACTAGATATAGATAGC
CAGAACAAATTTGATGTGAGCTTCTTCAAGAATGTACGTGATGGTAAAGGAGTTTTAGAGTCCGACCAAAGGCTGTGGGAAGATGCTGCGACACGCAATATCGTGCAAAACTATGCAGGC
ACCATTAGGGGGTTGCTTGGTTTTAGGTTTGATTTTGAATTTCCGAAAGCTATGATCAAAATGAGTAGCATCGAAGTGAAGACTGGCTCGGATGGGGAGATAAGAAAGATATGTTCGAAG
TTCAATTAG

Retrieve as FASTA