Entry information : CclPrx46 (clementine0.9_015860m)
Entry ID 8702
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx46 (clementine0.9_015860m)
Name (synonym) CclPrx46 (clementine0.9_015860m)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx46
start..stop
S start..stop
CsPrx47 656 0 1..322 1..323
CsPrx46 514 0 1..322 1..323
CclPrx83 513 0 1..322 1..323
MePrx88 478 8e-172 7..322 2..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4244751..4244957 207 N° 2 4245325..4245516 192 N° 3 4245609..4245774 166 N° 4 4246080..4246483 404
join(4244751..4244957,4245325..4245516,4245609..4245774,4246080..4246483)


exon

Literature and cross-references CclPrx46 (clementine0.9_015860m)
DNA ref. Phytozome 12:   scaffold_7 (4244751..4246483)
Protein sequence: CclPrx46 (clementine0.9_015860m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (301)
PWM (Da):   %s   35353.85 (33244.7)  
PI (pH):   %s   7.38 (7.06) Peptide Signal:   %s   cut: 22 range:22-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKASSIFFLISLIAVLGACSGGELRKNFYEETCPEAENIVHNIVWKNAALNPTLAAKLLRVHFHDCFVRGCDASVLIDSTESNSGEKDALPNETLGGFDVIEEVKTELEKKCPGIVSCADIVALAARDSVSFQFKRTLWEVLTGRRDGRISLASEANRDMPSPFFNFSSLQQSFENNGLTVHDLVVLSGGHTLGVGRCRFFRDRLYNFTGKGDADPSLNPTYAAFLRTKCRNVEDNKTAVGMDPGSDLSFDTNYFKILTQHKGLFQSDAALLTDKGARNFVNVLLDSKRFFMEFGLSMKRMGAIGVLTGNSGEIRKKCNVIN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGCTAGCTCAATTTTCTTCTTGATCTCTTTGATAGCAGTTTTAGGAGCTTGCAGTGGAGGGGAATTGAGGAAAAATTTTTACGAGGAAACTTGCCCCGAGGCTGAAAACATTGTG
CACAATATCGTTTGGAAAAATGCTGCACTCAATCCAACTTTGGCAGCAAAATTACTTAGAGTGCATTTCCACGATTGTTTTGTTAGG
GTAACAATAACACATGTCATCTTCATTTATTAT
TAGTCATAGCGATTTTTATAGTGATAATTAGAAATTTTTATTCACCCTAAAGATATTTTGCAAACATTATTTGTTCTTTTCAATACCAGCACGTCAGCATATTGTTACGGCCGCTAAAAT
TTACCTTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATACATATATAAATTTGTTTTAAATGAAAGCTCTGGTCCGAAGAGAAGTCA
CATTCTTTTTAAATACGAAGAAATAAAAAACATGTATCACAAATGCATGCTTTACAAGATTAATAAGCTTGTGATTTGATTGATTTTGTCTTAGGGTTGCGATGCCTCGGTATTGATAGA
CTCAACAGAAAGCAACTCAGGGGAAAAGGATGCACTTCCGAACGAAACCCTTGGAGGATTTGATGTTATAGAAGAAGTCAAAACTGAGCTTGAGAAGAAATGCCCCGGAATTGTTTCATG
TGCTGATATTGTAGCTCTCGCTGCTAGAGACTCCGTTTCCTTCCAA
GTAAGTTCTAAATTAAATTAACTATTTAAAAAGGAAAAAGAAAAAAAACACTTTCTCATGCCGCTATATTGTGG
TGATATTATATGCTACAGTTTAAGAGGACATTGTGGGAAGTGCTTACAGGAAGAAGAGACGGTAGAATTTCGCTTGCTTCGGAAGCGAATAGGGATATGCCTTCCCCCTTCTTCAACTTC
AGTAGTCTCCAACAATCTTTTGAAAACAACGGCCTTACTGTTCATGACCTAGTCGTTTTATCAG
GTAACGATAAATAAATTAAAAGCAATTAACCAAACCACATTTTTATCGTTAAAAGT
TAATTACAGTCAAAATTTTGATATGAAGCTACTAGTCAGTTAATGATTTATTAGGTGTATATTTATAGGCTATCGGATGGCTTTCTAAAACTTTGAATTTTACTTGTATGGGATTGTAAT
CGACAAATTTCAACTAAAAGAAATTCGGAGAACAGCCTTTGGCTTCCTCCTTAGCGCAAATAATTTCTTGAATAAAATTGATCTGAAAATATTTATAAATTTAGAGTGCATTGGCTATGA
CATGGGCAGGTGGACATACTCTTGGAGTTGGTCGCTGCAGATTCTTCCGCGACAGGCTGTACAATTTCACCGGAAAAGGTGATGCAGATCCATCATTGAATCCTACTTATGCTGCATTCT
TGAGAACCAAATGTAGAAACGTAGAAGATAACAAAACTGCAGTGGGAATGGACCCCGGCAGCGACTTGTCTTTTGATACCAATTACTTCAAAATCCTGACGCAACATAAAGGACTGTTCC
AATCTGATGCTGCACTTTTAACTGACAAGGGTGCCAGAAACTTTGTCAATGTGTTGCTCGATTCGAAAAGGTTTTTCATGGAGTTTGGTCTGTCCATGAAGAGAATGGGAGCCATTGGAG
TTCTTACGGGTAATTCAGGAGAGATCAGAAAGAAGTGCAATGTGATCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGCTAGCTCAATTTTCTTCTTGATCTCTTTGATAGCAGTTTTAGGAGCTTGCAGTGGAGGGGAATTGAGGAAAAATTTTTACGAGGAAACTTGCCCCGAGGCTGAAAACATTGTG
CACAATATCGTTTGGAAAAATGCTGCACTCAATCCAACTTTGGCAGCAAAATTACTTAGAGTGCATTTCCACGATTGTTTTGTTAGG
GGTTGCGATGCCTCGGTATTGATAGACTCAACA
GAAAGCAACTCAGGGGAAAAGGATGCACTTCCGAACGAAACCCTTGGAGGATTTGATGTTATAGAAGAAGTCAAAACTGAGCTTGAGAAGAAATGCCCCGGAATTGTTTCATGTGCTGAT
ATTGTAGCTCTCGCTGCTAGAGACTCCGTTTCCTTCCAA
TTTAAGAGGACATTGTGGGAAGTGCTTACAGGAAGAAGAGACGGTAGAATTTCGCTTGCTTCGGAAGCGAATAGGGATATG
CCTTCCCCCTTCTTCAACTTCAGTAGTCTCCAACAATCTTTTGAAAACAACGGCCTTACTGTTCATGACCTAGTCGTTTTATCAG
GTGGACATACTCTTGGAGTTGGTCGCTGCAGATTC
TTCCGCGACAGGCTGTACAATTTCACCGGAAAAGGTGATGCAGATCCATCATTGAATCCTACTTATGCTGCATTCTTGAGAACCAAATGTAGAAACGTAGAAGATAACAAAACTGCAGTG
GGAATGGACCCCGGCAGCGACTTGTCTTTTGATACCAATTACTTCAAAATCCTGACGCAACATAAAGGACTGTTCCAATCTGATGCTGCACTTTTAACTGACAAGGGTGCCAGAAACTTT
GTCAATGTGTTGCTCGATTCGAAAAGGTTTTTCATGGAGTTTGGTCTGTCCATGAAGAGAATGGGAGCCATTGGAGTTCTTACGGGTAATTCAGGAGAGATCAGAAAGAAGTGCAATGTG
ATCAATTAA

Retrieve as FASTA