Entry information : CclPrx51 (clementine0.9_016142m)
Entry ID 8707
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx51 (clementine0.9_016142m)
Name (synonym) CclPrx51 (clementine0.9_016142m)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx51
start..stop
S start..stop
CsPrx27 647 0 1..317 1..317
CpapPrx26 552 0 4..316 9..321
MePrx114 547 0 13..317 16..320
RcPrx74 537 0 15..317 15..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1081667..1081870 204 N° 2 1082004..1082192 189 N° 3 1082347..1082509 163 N° 4 1082600..1082997 398
join(1081667..1081870,1082004..1082192,1082347..1082509,1082600..1082997)


exon

Literature and cross-references CclPrx51 (clementine0.9_016142m)
DNA ref. Phytozome 12:   scaffold_22 (1081667..1082997)
Protein sequence: CclPrx51 (clementine0.9_016142m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (295)
PWM (Da):   %s   33881.34 (31708.2)  
PI (pH):   %s   10 (10.00) Peptide Signal:   %s   cut: 23 range:23-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAVVALIFALAMFPVSSPVSALSSNYYSKTCPKLETAVTNAVKKAMKNHKTVPAALLRMHFHDCFIRGCDASVLLESKGKNTAEKDGPPNISLHAFYVIDNAKKAVEAMCPGVVSCADILALSARDAVALSGGPTWDVPKGRKDGRISKATDTRQLPAPTFNISQLQQSFSQRGLSMADLVALSGGHSLGFSHCSSFQNRIHNFNATLDIDPSISPSFATSLRHVCPAHNKVKNAGATLDSSTTVFDNAYYKLLLPGKSLFSSDQSLLTTPKTKALVSKFARSKSAFENAFVQSMIRMSSITGGGQEIRLDCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCCGTTGTAGCTCTCATATTTGCCCTTGCAATGTTTCCAGTTTCTTCTCCAGTGAGTGCACTTAGCTCAAATTACTACTCGAAGACGTGCCCCAAGCTTGAGACAGCGGTCACC
AATGCTGTAAAGAAAGCAATGAAGAACCACAAAACAGTTCCCGCAGCTCTACTTCGCATGCACTTCCACGATTGCTTTATCAGA
GTGCGTAATTAACCATCTCATTCTCAAATGAATAAA
ATTTTGGTATTAGCCACACCTTGTACGTGAAGAAAACAAATTTCAAATGTGATTATTAATCTTATGTGGTGGTTTTTTTTTTCTTTTATAATGTAAGGGTTGTGATGCTTCGGTTCTTCT
GGAGTCAAAGGGGAAAAACACAGCTGAGAAAGATGGACCTCCTAACATCTCGTTGCATGCCTTTTATGTCATCGATAACGCAAAGAAAGCAGTTGAAGCTATGTGCCCTGGTGTGGTTTC
TTGTGCTGATATCTTAGCTCTCTCTGCTCGAGATGCAGTTGCTTTG
GTTAGTTTATATATACATATATGTATGAACCCATAATTATAAACACTGTTCGATACAACTAATAAATCTCCCCA
CCAAAAAAAAAAGTAAAAAAAAAAAGACTAAACATACATTTTTTGTTTGTTTGCTCTGCTGTTATGTGCTTACATACAAGTCTGGAGGTCCAACTTGGGATGTGCCGAAAGGGAGAAAAG
ACGGCAGAATTTCAAAAGCAACTGACACCAGACAGTTGCCAGCTCCCACCTTTAACATCTCTCAGCTTCAACAAAGCTTCTCCCAAAGAGGTCTTTCTATGGCTGATCTTGTCGCGCTCT
CAG
GTTAAAATGTTACTTTTGTAACTGTTGTGTTTCTGCTTAATTTTGACTGCAAAAATTAAAACGTGTATGCTAACCTCTAATTTTATATAGGAGGCCATTCTCTCGGGTTCTCTCACT
GCTCGTCCTTCCAAAACAGAATCCATAATTTTAATGCAACTCTTGACATTGACCCATCAATAAGCCCATCATTTGCAACAAGTTTGAGGCATGTGTGTCCGGCACACAACAAGGTGAAAA
ATGCCGGCGCCACGTTAGATTCATCAACAACAGTGTTTGACAATGCGTATTACAAGCTGCTTCTACCGGGGAAGAGTCTTTTCTCCTCAGATCAATCTTTGCTCACCACTCCAAAAACCA
AAGCCTTGGTTTCCAAGTTTGCCAGGTCCAAATCAGCATTTGAAAATGCTTTTGTGCAGTCCATGATCAGGATGAGTAGCATCACCGGTGGTGGTCAAGAGATTAGGCTTGATTGTAGAA
GAGTGAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCCGTTGTAGCTCTCATATTTGCCCTTGCAATGTTTCCAGTTTCTTCTCCAGTGAGTGCACTTAGCTCAAATTACTACTCGAAGACGTGCCCCAAGCTTGAGACAGCGGTCACC
AATGCTGTAAAGAAAGCAATGAAGAACCACAAAACAGTTCCCGCAGCTCTACTTCGCATGCACTTCCACGATTGCTTTATCAGA
GGTTGTGATGCTTCGGTTCTTCTGGAGTCAAAGGGG
AAAAACACAGCTGAGAAAGATGGACCTCCTAACATCTCGTTGCATGCCTTTTATGTCATCGATAACGCAAAGAAAGCAGTTGAAGCTATGTGCCCTGGTGTGGTTTCTTGTGCTGATATC
TTAGCTCTCTCTGCTCGAGATGCAGTTGCTTTG
TCTGGAGGTCCAACTTGGGATGTGCCGAAAGGGAGAAAAGACGGCAGAATTTCAAAAGCAACTGACACCAGACAGTTGCCAGCTCCC
ACCTTTAACATCTCTCAGCTTCAACAAAGCTTCTCCCAAAGAGGTCTTTCTATGGCTGATCTTGTCGCGCTCTCAG
GAGGCCATTCTCTCGGGTTCTCTCACTGCTCGTCCTTCCAAAAC
AGAATCCATAATTTTAATGCAACTCTTGACATTGACCCATCAATAAGCCCATCATTTGCAACAAGTTTGAGGCATGTGTGTCCGGCACACAACAAGGTGAAAAATGCCGGCGCCACGTTA
GATTCATCAACAACAGTGTTTGACAATGCGTATTACAAGCTGCTTCTACCGGGGAAGAGTCTTTTCTCCTCAGATCAATCTTTGCTCACCACTCCAAAAACCAAAGCCTTGGTTTCCAAG
TTTGCCAGGTCCAAATCAGCATTTGAAAATGCTTTTGTGCAGTCCATGATCAGGATGAGTAGCATCACCGGTGGTGGTCAAGAGATTAGGCTTGATTGTAGAAGAGTGAATTGA

Retrieve as FASTA