Entry information : CclPrx84 (clementine0.9_027900m / nd [1.0])
Entry ID 8715
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2015-04-15 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-04-15 (Christophe Dunand)
Peroxidase information: CclPrx84 (clementine0.9_027900m / nd [1.0])
Name (synonym) CclPrx84 (clementine0.9_027900m / nd [1.0])
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx84
start..stop
S start..stop
CclPrx113 624 0 1..319 1..318
RcPrx52 493 6e-178 1..319 1..317
PpePrx51 478 4e-172 1..319 1..319
PtPrx40 479 6e-172 7..319 51..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 622390..622602 213 N° 2 621529..621723 195 N° 3 620944..621109 166 N° 4 620018..620401 384
complement(join(620018..620401,620944..621109,621529..621723,622390..622602))


exon

Literature and cross-references CclPrx84 (clementine0.9_027900m / nd [1.0])
DNA ref. Phytozome 12:   scaffold_5 (12944890..12967801)
Protein sequence: CclPrx84 (clementine0.9_027900m / nd [1.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (294)
PWM (Da):   %s   33972.57 (31274.2)  
PI (pH):   %s   6.58 (6.14) Peptide Signal:   %s   cut: 25 range:25-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSHSHLYGTCFIMFLLLSKLAFAQLSSNHYDNTCPKALSTIKSIVHNAVVKEHRMGASLLRLHFHDCFVNQGCDASVLLDDTSSFTGEKSANANANSIRGFEAIDSVKSKV*SLCPGVVSCADILAVAARDSVVAFGGPSWTVQLGRRDSTTASSSAVNTNIPSPLMDLNDLISNFAKKGFSAKEMVALSGAHTIGQARCLLFRERIYNETNIDSEFATSLKSNCPSSGGDDNLSQLDATSSVLFDNGYFQDLVNNKGVFHSDQQLFNGGSTDSQVTTYSTIIGTFYADFANAMVKMGNLSPLTGTDGQICTNCRKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome(Gaps in frame which are completed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTCGTCTCACTCACATCTTTATGGAACTTGCTTCATCATGTTTTTGTTGTTATCTAAACTGGCCTTTGCACAATTATCCTCAAATCACTATGATAATACTTGCCCAAAAGCCCTATCTAC
CATCAAGTCTATAGTACACAATGCAGTGGTAAAGGAGCATCGAATGGGAGCTTCTTTGCTTCGTCTCCATTTCCACGATTGTTTTGTTAATGC
ACGTTCTATCTCTCCCTCTCTCTTTCT
TTTCACTTTCAACGAAAGCGATTTGCAATTGCAAACTTGCATGCATGCATCCGCCCAAAACGCATAATAGAGTTTCATTTACGCATTATCATAGTAATGCTTGAGTGACAAACTTTCTTT
GTATATGTTATTTAATTTGTACATAGTGAGGTGCTAAAACAGTATTAATTAGTAGAATCATGACTCAAAATAATCTCTTTTCATTAGCTATTTTTGTTAAGGTAAATGCTCCTTATAATT
TACATCAAGTCCAAAATATTTTCAAAATTACAATTTTCCAAAAAGTCCAGTTGTCTGTTTGTTTATGTTAAAATTTACTTAATTTTCATCTATTTTTCACCTATTGTATGTTAGATTTAT
TTGAATTTTAAGTTATATATCATGCGAAAATACTACTTTACTCTTAAAAATTAAATTTGATTGCTACGATAGTAACAACATAGGTGTTTTAGATAATTTTATAAATATAGGGATGAACTG
AATAATTAGCTCAAACCACATATAAAACTGAAGGAAATTTATTATTAATACATTTTTGTTATCAATATGGTTATCTTACAATTTGATTAGTTGGGCATATGATAGTGTATTATGGTAACT
TTTATTTTTAATTAAATTTCGTTTATGCCTCAATTTGCAGGGTTGTGATGCATCAGTTCTATTAGATGACACTTCAAGTTTTACTGGTGAGAAATCAGCCAACGCCAATGCGAATTCAAT
ACGAGGCTTTGAAGCGATCGATTCAGTTAAATCTAAAGTTTAGAGTCTCTGCCCTGGTGTTGTTTCTTGCGCAGACATCTTAGCTGTTGCTGCTCGAGATTCCGTTGTTGCTGT
AAGTGA
AGCGAAAATTGCATTAATGACTACTTGAGATTATTGTCACCTAATAGTAATAACTGCAGGCCCAAAATCTTAGCACTTTTCTTTATTATTATTGTTGGATTCTTATCATCGACTTAGGCT
TAATTTTGGTTAAACGGTTTCTCTAACACAATTAAATTCAATTCTCTCAACTTATAAGCTCATTCAATTTCTTGATTCACTTTTAAGCTCTTGTCTTTTGGTACATCCAAAACCTTTTTC
TTTTTCCTTTTTTTTCCCCTAATCTTTAGCCTACAAACATTTCACATAGGGAAGCATATGAAACCCTATCTTATCAGCTTAAACTTTTGGCCAAGCAGTTATTATTAGTATAATGGNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAGATATTCATTTTTGTTCTGTTCGGGGGGCCTTCATGGACAGTTCAATTAGGTAGAAGAGATTCGACAACGGCAAGTTCCAGTGCAGTA
AATACTAATATTCCATCCCCTCTTATGGATCTTAATGACCTTATTTCTAACTTTGCAAAGAAAGGATTCAGTGCTAAAGAAATGGTGGCCCTCTCAGGT
AATAACATTATTATTAGATTA
ATAAACTTAGACCTAGTGCTGATCTAAGCTGCACTAATCTTTCAAAATCATATCTCATCACCTGCACGACCAAAAAAGGCCTCTAGTATCAGCGGATCTACGAGTGCGTTAATAACATTG
TACGCATGGTAGAATTTAGTTACATGTATATACCTTGTAGAATGATCAACATAAGATTAGATAAATACTGATATGTATTGAAGATATTATCTCACATCAACTGAGAATAATTACTAGGTT
AATAATATAAGTGAGGCAATTCTCAATTCTTAAGCTAGTTTTTGAGTTTAAGTTAGCTCATGGGTTTTTTATATACTATTAGAGTTAGAGTCACCTACGAGTGGGCTCACTCTACTTTAT
CACGTGACAAGGACTAGCTAGACAAAAGAATCGGTACTGATGAGAATATCCCAAGTCAACTATTAACACAACTAGCTAGATAGCAGCCATATTCTTTAATTTCTATAATTCTTATTTCGT
GTATGATTAATTATATATCAAAATTCTGGTCGTATACAGGAGCTCACACAATAGGACAAGCTAGGTGCTTATTGTTTCGAGAAAGAATCTACAATGAAACAAACATTGATTCAGAATTTG
CAACATCTTTAAAATCAAACTGTCCAAGTTCAGGCGGCGATGACAACCTTTCTCAATTAGATGCCACCAGCTCTGTTCTATTTGACAATGGCTATTTCCAGGACTTGGTGAATAACAAAG
GTGTCTTTCATTCAGACCAGCAGGNNCTCTTCAATGGCGGCTCAACTGACTCTCAAGTCACCACTTACAGCACCATCATTGGAACGTTTTATGCAGATTTCGCCAATGCAATGGTCAAAA
TGGGGAACCTTAGCCCACTGACGGGGACTGATGGGCAGATTTGCACCAACTGCCGCAAAATAAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTCGTCTCACTCACATCTTTATGGAACTTGCTTCATCATGTTTTTGTTGTTATCTAAACTGGCCTTTGCACAATTATCCTCAAATCACTATGATAATACTTGCCCAAAAGCCCTATCTAC
CATCAAGTCTATAGTACACAATGCAGTGGTAAAGGAGCATCGAATGGGAGCTTCTTTGCTTCGTCTCCATTTCCACGATTGTTTTGTTAATGC
GGGTTGTGATGCATCAGTTCTATTAGA
TGACACTTCAAGTTTTACTGGTGAGAAATCAGCCAACGCCAATGCGAATTCAATACGAGGCTTTGAAGCGATCGATTCAGTTAAATCTAAAGTTTAGAGTCTCTGCCCTGGTGTTGTTTC
TTGCGCAGACATCTTAGCTGTTGCTGCTCGAGATTCCGTTGTTGCTGT
CGGGGGGCCTTCATGGACAGTTCAATTAGGTAGAAGAGATTCGACAACGGCAAGTTCCAGTGCAGTAAATAC
TAATATTCCATCCCCTCTTATGGATCTTAATGACCTTATTTCTAACTTTGCAAAGAAAGGATTCAGTGCTAAAGAAATGGTGGCCCTCTCAGGT
GCTCACACAATAGGACAAGCTAGGTG
CTTATTGTTTCGAGAAAGAATCTACAATGAAACAAACATTGATTCAGAATTTGCAACATCTTTAAAATCAAACTGTCCAAGTTCAGGCGGCGATGACAACCTTTCTCAATTAGATGCCAC
CAGCTCTGTTCTATTTGACAATGGCTATTTCCAGGACTTGGTGAATAACAAAGGTGTCTTTCATTCAGACCAGCAGGNNCTCTTCAATGGCGGCTCAACTGACTCTCAAGTCACCACTTA
CAGCACCATCATTGGAACGTTTTATGCAGATTTCGCCAATGCAATGGTCAAAATGGGGAACCTTAGCCCACTGACGGGGACTGATGGGCAGATTTGCACCAACTGCCGCAAAATAAAC

Retrieve as FASTA