Entry information : CclPrx88 (clementine0.9_028889m)
Entry ID 8719
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-05 (Qiang Li)
Peroxidase information: CclPrx88 (clementine0.9_028889m)
Name (synonym) CclPrx88 (clementine0.9_028889m)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx88
start..stop
S start..stop
CsPrx31 691 0 1..337 9..345
PpePrx77 505 0 1..330 12..341
GrPrx02 498 3e-179 3..330 12..337
BrPrx61-1Aa_other 496 2e-178 1..332 6..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 817867..818094 228 N° 2 818965..819144 180 N° 3 819491..819650 160 N° 4 820012..820457 446
join(817867..818094,818965..819144,819491..819650,820012..820457)


exon

Literature and cross-references CclPrx88 (clementine0.9_028889m)
DNA ref. Phytozome 11:   scaffold_46 (817867..820457)
Protein sequence: CclPrx88 (clementine0.9_028889m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (318)
PWM (Da):   %s   37369.77 (35446.7)  
PI (pH):   %s   7.86 (8.04) Peptide Signal:   %s   cut: 20 range:20-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MILPLVALALSLFVANADAAVSLPQPVKLEWHYYKVYNTCHDAEAYIRHQVELFYKHDKTIAPKLLRLLYSDCFVTGCDASILLDGPNSEKTAPQNWGLGAFVLIDKIKVVLEQRCPGAVSCSDILNLATRDAVHMAGAPSYPVFTGRRDGMTSTKESVDLPSPSISWKESLACFQSKGLDVQDMVTLLGAHTMGQTRCRYIVDRLYNYKNTGKPDPSMNTTLLNQLRKECLPRTRKGQSDPLVYLNPETGSSYRFSESYYSRVKTHEAVLGVDQQLSNGDNNTLQIVDEFAAGFEDFRKALALSMSRMGSINVLTGKQGEIRRNCRCTNADTNCKR

Retrieve as FASTA  
Remarks Complete sequence from genomic. Containing motif 'YSDC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTCTCCCACTGGTGGCTCTGGCACTGAGCTTGTTTGTGGCCAACGCCGATGCGGCGGTGTCGCTGCCGCAGCCGGTGAAATTGGAATGGCACTATTACAAGGTTTATAATACATGC
CATGATGCAGAGGCATATATCAGGCACCAAGTGGAGTTGTTCTATAAACATGATAAAACCATCGCCCCTAAACTCCTCCGTTTGCTCTACTCTGACTGCTTTGTAACT
GTATGTCTCTTT
ATCATTTTTTCCTTTCTAAATTTTGCCCTTTTTATTTCTGATCTTTACTTATCATTTTGTTTTAACTCTAGAGAATTTTGATTAGAAATTGCTTTTTACTAGCTTGGTTCTTTCTTCAGA
AGCACTTGGCAGTTTTTCCGGGAGAAGCTGTTTAAGGAAATACTGAAATGCTTCTCTATTCCAAGCAATAGCTTCTTGGAAAAGAACATGATATGTGTATTTTCATTGATGCTCGGCTGT
ATAGAAACTTGCTATCGTCTTATTATAAGCTGATTTTACGGGAAAATGATGAAAACTCTTTTAGTAAATTAGTCATTTCTCTCCTCACTTTTCAAAACTCGTCAAAATTTTCCTGCAGTT
AAAAAAAAAAGGGTCAACTTTCAATTATTTATTTCTACTATTTTATCTCTGAATTGATGAAACCCACAATCGATTGACAAAAACTTCTAAGACAGAAATTAATTGATGAAAATTTCAAAA
GACAATAATTTTTTTTAAAATACTTTAGAACATGAGAAAAAAAAATGATTAATTTCGGCTTTTGATCATTTTCTCCTGATTTTACCAAAAGCATGCGCTGTGAACGTGGTTTAATGCTAA
AGAAAACAATTAATGCTACTGCTATAAGTTACGGCTGACCTAAACATTTTTCAGAATTTGCCCCAATTATTAATTTCACAGAACATGGCCTTGGCGTCGCCGGCAAGCATGCCCAGCAAT
TTCTATGTTTCTCTTTAATAACGTAACTATGGTTAGGTTAATTTGCTCAATAATATATGTTTCGCGGTATCACAAAAATTTTACCTATGCAATTGAATGTTAAATTTATGGTGATGTATC
GTGATTTGCTAAATCCAGGGATGTGATGCATCAATTCTGCTTGATGGACCAAACTCAGAAAAGACTGCACCACAAAACTGGGGACTTGGGGCATTCGTTCTCATCGACAAGATCAAAGTT
GTTCTTGAACAACGCTGCCCAGGTGCCGTCTCTTGTTCCGATATACTCAACCTTGCCACCAGGGATGCCGTTCACATG
GTATGCGTTTTTATTTTGCTTCCCCTATATTTTATATAATTT
TTTGCATTCTAATATAAATTGCAAACTTATTTCCGGGTAATTTAACGCTCAAACAGTCACGACGAGGTTTAAAAGTAACCATTTTTTACCGGCCACCCCAATCTCGAATCCTAGGGAGAT
TGGGGGTTTAAAAAAGCCAATTCGGATTTCGCCCACCCCTACGTCTTAGAAAAATAAACAATCAATTGAAAAGGCATAAAATTTAAAAAATAAAGATGCAGGCACCGTAAGGGCATATTG
AGGAATTGCGACCATTTATAAGTTGTTAACTAAGTCACTAATTCATATTTTGATGAATCAACAGGCAGGCGCACCATCTTATCCTGTGTTTACAGGAAGAAGGGACGGTATGACATCAAC
CAAAGAATCTGTAGACCTCCCATCACCGTCCATCTCATGGAAAGAATCTTTGGCATGCTTCCAATCCAAAGGTTTAGATGTGCAGGACATGGTAACCCTCCTAG
GTAAGGTTCTCTAATA
CCTCAAAAGAATCTATTAAACGAACCAATAAAACCAGCGAAAGTAAGAAAAGCTAAAACCCCCCAAACAAAAAAAATTCAGAGATTTAACAGTACAAACACTGTATGAATCTCAGTTGCA
TTTGCTGATGGAGAAAATCAGAAATATATTTCCTAAGCAGGAAATATGAAAAGGTAGTTCAAAATATGTAAAAGCCTGAACTCACGTTCTCCATCTCAGGGAGAAAAAAAATTTCTAAAA
TTCTCTGTATAAGCTACCATTCATCACTTTGTTAATTCAGTGAATTCTTTCCATTTCACCCGGTACCGTTCTTCACTTAAAATAACTTTTCTTCCTCTATTTCAGGAGCACACACAATGG
GCCAAACTCGATGCCGCTACATTGTTGACCGGCTCTACAATTACAAAAATACTGGAAAGCCAGACCCAAGTATGAACACGACACTTTTAAATCAACTGAGAAAGGAGTGTCTGCCCAGAA
CAAGAAAGGGTCAATCTGATCCACTTGTTTATCTAAACCCAGAAACTGGCTCCAGTTACAGATTTTCTGAGTCCTACTACTCCAGAGTTAAGACACATGAAGCAGTTCTTGGAGTTGACC
AGCAGTTATCCAATGGTGATAACAACACGCTTCAAATTGTTGATGAATTTGCTGCTGGTTTTGAAGATTTTAGGAAAGCATTAGCTCTGTCAATGAGTCGGATGGGCAGCATTAATGTTT
TGACTGGGAAGCAGGGGGAGATACGCAGAAATTGCCGATGCACAAATGCAGATACTAATTGCAAAAGGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTCTCCCACTGGTGGCTCTGGCACTGAGCTTGTTTGTGGCCAACGCCGATGCGGCGGTGTCGCTGCCGCAGCCGGTGAAATTGGAATGGCACTATTACAAGGTTTATAATACATGC
CATGATGCAGAGGCATATATCAGGCACCAAGTGGAGTTGTTCTATAAACATGATAAAACCATCGCCCCTAAACTCCTCCGTTTGCTCTACTCTGACTGCTTTGTAACT
GGATGTGATGCA
TCAATTCTGCTTGATGGACCAAACTCAGAAAAGACTGCACCACAAAACTGGGGACTTGGGGCATTCGTTCTCATCGACAAGATCAAAGTTGTTCTTGAACAACGCTGCCCAGGTGCCGTC
TCTTGTTCCGATATACTCAACCTTGCCACCAGGGATGCCGTTCACATG
GCAGGCGCACCATCTTATCCTGTGTTTACAGGAAGAAGGGACGGTATGACATCAACCAAAGAATCTGTAGAC
CTCCCATCACCGTCCATCTCATGGAAAGAATCTTTGGCATGCTTCCAATCCAAAGGTTTAGATGTGCAGGACATGGTAACCCTCCTAG
GAGCACACACAATGGGCCAAACTCGATGCCGC
TACATTGTTGACCGGCTCTACAATTACAAAAATACTGGAAAGCCAGACCCAAGTATGAACACGACACTTTTAAATCAACTGAGAAAGGAGTGTCTGCCCAGAACAAGAAAGGGTCAATCT
GATCCACTTGTTTATCTAAACCCAGAAACTGGCTCCAGTTACAGATTTTCTGAGTCCTACTACTCCAGAGTTAAGACACATGAAGCAGTTCTTGGAGTTGACCAGCAGTTATCCAATGGT
GATAACAACACGCTTCAAATTGTTGATGAATTTGCTGCTGGTTTTGAAGATTTTAGGAAAGCATTAGCTCTGTCAATGAGTCGGATGGGCAGCATTAATGTTTTGACTGGGAAGCAGGGG
GAGATACGCAGAAATTGCCGATGCACAAATGCAGATACTAATTGCAAAAGGTAA

Retrieve as FASTA