Entry information : SbPrx15 (Sobic.001G360400.1[2.1]Sb01g034420[1.4])
Entry ID 872
Creation 2008-10-13 (Christophe Dunand)
Last sequence changes 2008-10-13 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-01 (Messaoudi)
Peroxidase information: SbPrx15 (Sobic.001G360400.1[2.1]Sb01g034420[1.4])
Name (synonym) SbPrx15 (Sobic.001G360400.1[2.1]Sb01g034420[1.4])
Class Class III peroxidase    [Orthogroup: Prx092]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Seedlings
Inducers Nitrogen starvation
Phosphate starvation
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx15
start..stop
S start..stop
ZmPrx145 605 0 3..332 2..336
ZmPrx144 582 0 19..332 24..337
SiPrx155 559 0 3..332 2..320
OsPrx47 548 0 3..332 2..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 57864613..57864849 237 N° 2 57863736..57864497 762  
complement(join(57863736..57864497,57864613..57864849))


exon

Literature and cross-references SbPrx15 (Sobic.001G360400.1[2.1]Sb01g034420[1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_1 (57864849..57863736)
Protein sequence: SbPrx15 (Sobic.001G360400.1[2.1]Sb01g034420[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (310)
PWM (Da):   %s   34614.36 (32558.2)  
PI (pH):   %s   7.36 (7.05) Peptide Signal:   %s   cut: 23 range:23-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASKVPALLSCAFLLLGAAAGYYSPPSPASCELKVGYYHHKCPPAEAIVKSVVGAAVRQNPGVGAGLIRMLFHDCFVEGCDASVLLDPTPANPQPEKLGSPNNPSLRGFEVIDAAKAAVERACPGVVSCADIVAFAARDASFFLGGRGVDFDMPAGRLDGRVSNASRTLDFLPPPTSNLSGLVQSFAAKGLGVDDMVVLSGAHTVGRSHCSSFVPDRLAVPSDISPSFAASLRGQCPASPSSSNDPTVVQDVVTPDKLDSQYYKNVLAHRVLFTSDASLLSSPATAKMVSDNANIPGWWEDRFKAAMVKMASVEVKTGNSGEIRRNCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1) and 9 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGAGCAAGGTGCCTGCACTGCTCTCATGTGCGTTCTTGCTCCTAGGAGCAGCAGCTGGTTACTACAGTCCTCCGAGTCCTGCTTCGTGCGAGCTCAAGGTGGGATACTACCAC
CACAAGTGCCCCCCCGCCGAGGCCATCGTCAAGAGCGTCGTCGGAGCCGCCGTCCGGCAGAACCCCGGCGTCGGCGCCGGCCTCATTCGCATGCTCTTCCACGACTGCTTCGTCGAG
GTA
CATTATTATCTTTCAATTCTATTTCTACACGTACGCACTGCTGCTCAATGCTCATGCAATCATGCATGAGATGGCTTGTACTGACGCCACGCCATGGTATATACAAAAAAAGGGCTGCGA
CGCCTCCGTCCTGCTGGACCCGACGCCGGCCAACCCGCAGCCAGAGAAGCTCGGCTCGCCCAACAACCCCAGCCTCCGGGGCTTCGAGGTCATCGACGCCGCCAAGGCCGCGGTCGAGCG
GGCGTGCCCGGGCGTCGTCTCCTGCGCGGACATCGTCGCCTTCGCCGCCCGCGACGCCTCCTTCTTCCTCGGCGGCCGCGGGGTCGACTTCGACATGCCCGCCGGCCGCCTCGACGGCCG
CGTCTCCAACGCCTCGCGCACCCTCGACTTCCTCCCGCCGCCGACCTCCAACCTCTCCGGGCTCGTCCAGAGCTTCGCCGCCAAGGGCCTCGGCGTCGATGACATGGTCGTGCTCTCGGG
CGCGCACACCGTCGGCCGCTCCCACTGCTCGTCCTTCGTCCCCGACCGCCTCGCCGTTCCTTCGGACATCAGCCCCTCCTTCGCCGCGTCTCTGAGGGGCCAGTGCCCGGCAAGCCCCAG
CTCCAGCAATGACCCCACCGTCGTGCAGGACGTCGTGACGCCCGACAAGCTGGACAGCCAGTATTACAAGAACGTGCTGGCGCACAGAGTTCTCTTCACGTCGGACGCCTCACTCCTCTC
GTCACCGGCGACGGCGAAGATGGTCTCGGACAATGCCAACATCCCTGGGTGGTGGGAGGACAGGTTCAAGGCGGCCATGGTGAAGATGGCCAGTGTCGAGGTGAAGACCGGCAACAGCGG
CGAGATCAGGAGGAACTGCCGGGTCGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGAGCAAGGTGCCTGCACTGCTCTCATGTGCGTTCTTGCTCCTAGGAGCAGCAGCTGGTTACTACAGTCCTCCGAGTCCTGCTTCGTGCGAGCTCAAGGTGGGATACTACCAC
CACAAGTGCCCCCCCGCCGAGGCCATCGTCAAGAGCGTCGTCGGAGCCGCCGTCCGGCAGAACCCCGGCGTCGGCGCCGGCCTCATTCGCATGCTCTTCCACGACTGCTTCGTCGAG
GGC
TGCGACGCCTCCGTCCTGCTGGACCCGACGCCGGCCAACCCGCAGCCAGAGAAGCTCGGCTCGCCCAACAACCCCAGCCTCCGGGGCTTCGAGGTCATCGACGCCGCCAAGGCCGCGGTC
GAGCGGGCGTGCCCGGGCGTCGTCTCCTGCGCGGACATCGTCGCCTTCGCCGCCCGCGACGCCTCCTTCTTCCTCGGCGGCCGCGGGGTCGACTTCGACATGCCCGCCGGCCGCCTCGAC
GGCCGCGTCTCCAACGCCTCGCGCACCCTCGACTTCCTCCCGCCGCCGACCTCCAACCTCTCCGGGCTCGTCCAGAGCTTCGCCGCCAAGGGCCTCGGCGTCGATGACATGGTCGTGCTC
TCGGGCGCGCACACCGTCGGCCGCTCCCACTGCTCGTCCTTCGTCCCCGACCGCCTCGCCGTTCCTTCGGACATCAGCCCCTCCTTCGCCGCGTCTCTGAGGGGCCAGTGCCCGGCAAGC
CCCAGCTCCAGCAATGACCCCACCGTCGTGCAGGACGTCGTGACGCCCGACAAGCTGGACAGCCAGTATTACAAGAACGTGCTGGCGCACAGAGTTCTCTTCACGTCGGACGCCTCACTC
CTCTCGTCACCGGCGACGGCGAAGATGGTCTCGGACAATGCCAACATCCCTGGGTGGTGGGAGGACAGGTTCAAGGCGGCCATGGTGAAGATGGCCAGTGTCGAGGTGAAGACCGGCAAC
AGCGGCGAGATCAGGAGGAACTGCCGGGTCGTCAACTAG

Retrieve as FASTA