Entry information : CclPrx90 ( clementine0.9_029129m)
Entry ID 8721
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-14 (Christophe Dunand)
Peroxidase information: CclPrx90 ( clementine0.9_029129m)
Name (synonym) CclPrx90 ( clementine0.9_029129m)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx90
start..stop
S start..stop
CsPrx32 742 0 1..371 1..371
MePrx102 424 1e-149 1..324 1..319
EcamPrx48 411 9e-145 21..321 21..319
MguPrx50 411 1e-144 4..324 3..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8562939..8563142 204 N° 2 8561584..8562495 912  
complement(join(8561584..8562495,8562939..8563142))


exon

Literature and cross-references CclPrx90 ( clementine0.9_029129m)
DNA ref. Phytozome 12:   scaffold_3 (8563142..8561584)
Protein sequence: CclPrx90 ( clementine0.9_029129m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   371 (350)
PWM (Da):   %s   40707.89 (38227.5) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.56 (9.15) Peptide Signal:   %s   cut: 22 range:22-371
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRTKGSFVLFFFFFIFPLALAQLRPGFYGTSCPRAESIVSDLVQKRFSADNSVTAALLRMHFHDCFVTGCDASILIDSTNQTQSEKESGANQTVREFELIDEIKKALEAECPSTVSCADIITLATRDAVTLVGGPRYTVLTGRRDGLRSNVDDVDLPGPQISVPDAQQVFQAKGLTSDEMVSLLGAHTVGFAHCSFFKDRLTNFQGTGLPDPTMNVTLIPKLRRICDAASTDNFGPKTFLDQSTNFVFDNKFHSEILSRRGILQIDQELALDRSTDPMVSKFAFNSDEFLRSFASAMVKMGNIQVLVGNAGEIRQNCRAFNPLKASTPSNPDNTPKPIPKPKPKPRPRPGKGGRKQKPPGKGRKNKIPRIF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1). Incorrect prediction from phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAACCAAAGGCTCATTTGTTCTCTTTTTCTTCTTCTTCATCTTTCCGCTCGCGTTAGCTCAACTAAGGCCTGGTTTTTATGGCACAAGTTGCCCTAGAGCAGAATCAATTGTTTCC
GATTTGGTGCAAAAACGATTTAGTGCTGATAATTCCGTAACTGCAGCTCTGCTTCGTATGCATTTTCATGATTGCTTTGTTACA
GTAAGTAGTATTTCTATTTTTAACACTTAACTAGCT
AGTACTCATTATATCGATGCAAAAATTTGAAAATTCATTAAAGAATCTCCTCTAAAATTTATGAGAGAGTACGATGATGGGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNCAAATAACATATGGTAACTAATTTCTTCTATAACAATATTAGCAGAATTTGAATCCTAATCCTGTCTAAAGCATTTTATTGGTTGAACTGATTGACCCACAATAATTTCAT
ATTCGAACTATAAACTTATTTCGATAGTTTCAAAAATAAATAAATACACGATACATGCTTACTTTTTCTTATATAATGAGTTCTTATATAATGAGTATTGTATTAGTTGACAGTATCTTC
ATTTTTCTTTTCCACTAATTTGAACAATTCATTTTTGCTTGTTCTAGGGTTGTGATGCTTCCATTCTTATAGACTCAACAAACCAAACCCAATCAGAGAAAGAATCGGGAGCAAACCAAA
CAGTTCGAGAATTCGAGCTCATTGATGAGATCAAGAAAGCCCTAGAGGCCGAATGCCCTTCAACCGTTTCATGTGCAGACATCATCACGCTCGCCACCCGCGACGCGGTGACACTAGTCG
GAGGCCCCCGTTACACCGTTCTCACCGGAAGAAGAGACGGTCTTCGATCAAACGTTGACGATGTCGACTTGCCAGGACCACAAATATCTGTGCCTGATGCCCAGCAAGTATTTCAAGCGA
AAGGCCTGACGTCAGACGAAATGGTAAGCCTTCTGGGAGCTCACACTGTTGGCTTTGCTCATTGTAGCTTCTTTAAGGACCGGCTGACAAACTTTCAAGGAACTGGGCTTCCTGATCCTA
CAATGAATGTTACTTTGATCCCGAAGCTCAGAAGAATTTGCGATGCTGCGTCTACTGATAATTTTGGACCAAAAACGTTTTTGGACCAAAGCACAAACTTTGTGTTTGATAACAAGTTTC
ACAGCGAGATTCTTTCACGTAGAGGGATACTTCAGATTGATCAGGAACTTGCTTTGGATAGATCTACAGATCCAATGGTTTCTAAATTCGCGTTTAATTCGGATGAGTTTCTGAGGAGTT
TTGCAAGTGCAATGGTTAAGATGGGAAACATACAAGTTCTTGTGGGAAATGCTGGAGAAATTAGACAAAATTGTAGAGCTTTCAATCCACTCAAAGCGTCGACACCATCAAATCCGGACA
ACACCCCCAAACCGATACCAAAACCGAAGCCGAAACCGAGACCGAGGCCAGGCAAGGGGGGAAGGAAACAGAAACCGCCAGGGAAGGGGAGAAAGAATAAGATACCAAGAATATTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAACCAAAGGCTCATTTGTTCTCTTTTTCTTCTTCTTCATCTTTCCGCTCGCGTTAGCTCAACTAAGGCCTGGTTTTTATGGCACAAGTTGCCCTAGAGCAGAATCAATTGTTTCC
GATTTGGTGCAAAAACGATTTAGTGCTGATAATTCCGTAACTGCAGCTCTGCTTCGTATGCATTTTCATGATTGCTTTGTTACA
GGTTGTGATGCTTCCATTCTTATAGACTCAACAAAC
CAAACCCAATCAGAGAAAGAATCGGGAGCAAACCAAACAGTTCGAGAATTCGAGCTCATTGATGAGATCAAGAAAGCCCTAGAGGCCGAATGCCCTTCAACCGTTTCATGTGCAGACATC
ATCACGCTCGCCACCCGCGACGCGGTGACACTAGTCGGAGGCCCCCGTTACACCGTTCTCACCGGAAGAAGAGACGGTCTTCGATCAAACGTTGACGATGTCGACTTGCCAGGACCACAA
ATATCTGTGCCTGATGCCCAGCAAGTATTTCAAGCGAAAGGCCTGACGTCAGACGAAATGGTAAGCCTTCTGGGAGCTCACACTGTTGGCTTTGCTCATTGTAGCTTCTTTAAGGACCGG
CTGACAAACTTTCAAGGAACTGGGCTTCCTGATCCTACAATGAATGTTACTTTGATCCCGAAGCTCAGAAGAATTTGCGATGCTGCGTCTACTGATAATTTTGGACCAAAAACGTTTTTG
GACCAAAGCACAAACTTTGTGTTTGATAACAAGTTTCACAGCGAGATTCTTTCACGTAGAGGGATACTTCAGATTGATCAGGAACTTGCTTTGGATAGATCTACAGATCCAATGGTTTCT
AAATTCGCGTTTAATTCGGATGAGTTTCTGAGGAGTTTTGCAAGTGCAATGGTTAAGATGGGAAACATACAAGTTCTTGTGGGAAATGCTGGAGAAATTAGACAAAATTGTAGAGCTTTC
AATCCACTCAAAGCGTCGACACCATCAAATCCGGACAACACCCCCAAACCGATACCAAAACCGAAGCCGAAACCGAGACCGAGGCCAGGCAAGGGGGGAAGGAAACAGAAACCGCCAGGG
AAGGGGAGAAAGAATAAGATACCAAGAATATTTTAA

Retrieve as FASTA